KEGG   Cyanothece sp. ATCC 51142: cce_1455Help
Entry
cce_1455          CDS       T00686                                 

Gene name
thrC1
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cce_1455 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cce_1455 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    cce_1455 (thrC1)
Enzymes [BR:cyt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     cce_1455 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1463387..1464517
Genome map
AA seq 376 aa AA seqDB search
MTVQSLTSFPSVSPSTTVIAPSSDVKPWLGLIETYRPYLPVTENTPVVTLLEGNTPLIPV
PYISQQVGKGVKVFVKYDGLNPTGSFKDRGMTMAISKAKEDGAKAVICASTGNTSAAAAA
YARRAGMRAFVIIPDGYVALGKLAQALLYGAEVIAIDGNFDDALTVVKQMAENYPVTLVN
SVNPYRLEGQKTAAFEVVDVLGNAPDWLCIPVGNAGNISAYWMGFCQYHSLGKTNKLPKM
MGFQAAGAAPFIGGQPVAKPETLATAIRIGNPANWDKAWGAKDASQGEFNAVTDEEILDA
YRLLAAHEGVFCEPASAASVAGLLKVKDRVPTEATVVCVLTGNGLKDPDCAIQHSNNQVK
SGIKPELSQVAKVMGF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcaatcgttaacgtcgttcccttcagtctccccctcgacaacagtgatcgca
ccttcatcagacgttaaaccttggctggggttaatagaaacctatcgcccttatcttccc
gttaccgaaaacactccagttgtgaccctacttgaaggcaatacccctcttattcctgtc
ccctacatctctcaacaagtgggcaaaggggttaaagtttttgttaaatacgatggtttg
aaccccaccggtagttttaaagatcgggggatgactatggctatttccaaagccaaagaa
gatggggcaaaagccgttatctgcgccagtacagggaacacctctgctgctgctgctgct
tacgctagacgggccggaatgcgagcttttgtgattattccggatggttatgtggcttta
ggcaaactagcacaagccttattatacggtgccgaagttatcgccattgacgggaacttt
gatgatgcgttgacggtggttaaacagatggccgaaaattatcccgttacgttggttaac
tcggtcaacccttaccgtttagaaggtcaaaaaaccgcagcctttgaagtggtggatgtc
ttggggaatgctcccgactggttatgtatcccagtgggtaacgcagggaatattagtgct
tactggatgggattttgtcaatatcatagtttagggaaaaccaataaattgccgaaaatg
atgggctttcaagcagcaggggcagccccgtttattgggggtcaacctgtggctaaacca
gaaaccctcgctactgccattcgtattggtaacccggccaactgggacaaagcatggggg
gcaaaagatgccagtcaaggagaatttaatgcagttacggatgaggaaattttagacgct
tatcgtctcttggccgcccacgaaggggtcttttgtgaacctgctagtgcagcatcggtg
gccgggttattgaaagttaaagatcgggttcccactgaggctaccgtagtttgtgtattg
acaggtaatggtttaaaagatcctgactgtgccattcaacatagtaataatcaagttaag
tctggcattaaacctgaattatcgcaagtagctaaggtaatgggtttttga

DBGET integrated database retrieval system