KEGG   Cyanothece sp. ATCC 51142: cce_1474Help
Entry
cce_1474          CDS       T00686                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    cce_1474 (malQ)
Enzymes [BR:cyt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     cce_1474 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1487234..1488739)
Genome map
AA seq 501 aa AA seqDB search
MTFYQRASGILLHPTSLPSRFGIGDLGEGPYRFIDFLVASGQTLWQVLPLGPTGYGNSPY
LSYSAFAGNPLLISPDILYGDGLVTQADLDTYPDLPDDRVDYDLVVKYKVPLLKKASDTF
KNGGSPELRGEFDQFCARHSYWLEDYALFMAIHDDNPKKGWHQWDRDIAKREPQALEAYR
AKYAEAIFYHKFVQFEFVRQWKRVKKYANDRNVKIFGDIPIYVAYDGADVWSHSDIFCVD
PETLAVNVMAGVPPDYFSATGQLWGNPVYNWQKVQEHDFSWWIERFKSTLEYYDVVRIDH
FRGFEAYWAVPKGETTAMNGQWLKAPGDAFFARLKEVLGTLPIVAEDLGVITPEVEALRD
KYEFPGMKLLHFAFDSDRANPFLPYNYTNPNCVVYTGTHDNNTTIGWFAERNFEEQARVT
DYLSGISPKGIHWTLISLAMGSVANQAVFPLQDILGLESHCRMNTPGLADGNWTWRYRPE
MLTPELTEYLRYVTELYGRIV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacattttatcagagagctagtgggattttattgcacccaacctctttacccagtcgt
tttggtattggtgacttgggagaaggaccctatcgcttcattgactttttagtcgctagt
ggacaaaccctctggcaagttttacccctgggtccaacaggatatggcaattctccttat
ctttcttactctgcatttgcagggaaccctttattaattagtcctgatattctctacgga
gatggtttagttacccaagcagacttagatacttatcctgatcttcctgatgaccgggtt
gattacgatttagttgtcaaatataaagtcccccttctgaaaaaagcaagtgatacgttt
aaaaatggaggttctccagaactaagaggagaatttgaccaattttgcgcccgtcatagc
tattggttagaagattatgctttattcatggctatccatgacgataatcccaaaaaagga
tggcatcaatgggatcgtgatattgctaagcgtgaaccccaagctttagaagcttatcgg
gctaagtatgcagaggcaattttctatcataagtttgttcaatttgagtttgtccgtcag
tggaaacgagtcaaaaaatacgccaatgatcgcaatgtgaaaatttttggcgatattcct
atctatgtagcctatgatggggctgatgtttggtcccattctgatattttctgtgttgac
ccagaaaccctagccgtgaatgtcatggccggtgttcccccagattattttagtgctact
ggtcaattatgggggaatcccgtttataactggcaaaaagtccaagaacatgactttagt
tggtggatcgaacggtttaaaagcaccttagaatattatgatgtggtaagaattgaccat
ttccgagggtttgaagcttactgggcggttcctaaaggagaaacaacggctatgaatggg
caatggttaaaagccccaggtgatgccttttttgcccgtcttaaagaagtattaggaact
ttacccattgttgctgaggatttaggggtaattacccccgaagtcgaagctttacgggat
aagtatgagtttcctgggatgaagttactacacttcgcctttgactcagatcgagctaat
cctttcttaccttataactataccaatccgaattgtgtcgtttacaccggaacccatgac
aacaacacaaccatcggctggtttgcagaacgaaattttgaagaacaagccagagttacg
gattatttatcgggtatttctcctaaaggtatccattggaccttgattagcttagctatg
ggttcagtggccaatcaagcagtgtttcccctgcaagatattttaggcttagaaagtcac
tgccgtatgaatactccagggttagccgatggtaactggacatggcggtatcgtcccgaa
atgttaacccctgaattaacggaatatttacgctatgtgactgaattgtatggcagaata
gtctaa

DBGET integrated database retrieval system