KEGG   Cyanothece sp. ATCC 51142: cce_1542Help
Entry
cce_1542          CDS       T00686                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cce_1542 (gpmA)
   01230 Biosynthesis of amino acids
    cce_1542 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_1542 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    cce_1542 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cce_1542 (gpmA)
Enzymes [BR:cyt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     cce_1542 (gpmA)
Exosome [BR:cyt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   cce_1542 (gpmA)
  Exosomal proteins of melanoma cells
   cce_1542 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1550743..1551444
Genome map
AA seq 233 aa AA seqDB search
MAKLILLRHGQSLWNAANKFTGWVDVPLSERGRAEATVASCKLRDKGYKIDVCFTSLLIR
SIETAVICLTECDQICGEKIPIIQHDSDDPDWHGWDKYAGNFYQELPIFTSQALDERYYG
NLQGLNKAETAEKFGEEKVHEWRRSYSSRPPGGESLEDTKNRVIPYFQSRISDHIKRGQT
VLVAAHGNSLRAMVMALDNLEPDEVPGLELTTGVPIIYDFDDQGNVLEKTILT
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattaatcttactacgtcatggacaaagtctttggaatgctgctaataaattt
actgggtgggttgatgttcccttgagtgaaagaggacgtgcagaagcaacggtagcctct
tgtaaattacgggataaaggttataaaattgacgtttgttttaccagtttactaattaga
agtattgaaactgctgtcatttgtttaacggaatgtgaccaaatttgtggtgaaaaaatt
cctattattcaacatgattctgatgatcctgattggcacggttgggataaatatgctggt
aatttttatcaagaattacccatttttacttcccaagctttagatgagcgttattatggc
aatttgcaaggattaaataaagcagaaacagccgaaaaatttggtgaagaaaaagtccat
gagtggcggcgttcctactcctctcgtcctcccggtggggaaagtttggaagatacaaaa
aatcgagttattccctattttcaaagccgaatttcagaccatattaagcgaggacaaacg
gttttagtcgctgctcatggcaactccttaagggcgatggttatggcattagacaacctt
gaacccgatgaagttccagggttagaattgaccactggagtccccattatttacgatttt
gatgatcagggcaacgtattagaaaaaacaatattaacttaa

DBGET integrated database retrieval system