KEGG   Cyanothece sp. ATCC 51142: cce_1542Help
Entry
cce_1542          CDS       T00686                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cce_1542 (gpmA)
   01230 Biosynthesis of amino acids
    cce_1542 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_1542 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    cce_1542 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cce_1542 (gpmA)
Enzymes [BR:cyt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     cce_1542 (gpmA)
Exosome [BR:cyt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   cce_1542 (gpmA)
  Exosomal proteins of melanoma cells
   cce_1542 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1550743..1551444
Genome map
AA seq 233 aa AA seqDB search
MAKLILLRHGQSLWNAANKFTGWVDVPLSERGRAEATVASCKLRDKGYKIDVCFTSLLIR
SIETAVICLTECDQICGEKIPIIQHDSDDPDWHGWDKYAGNFYQELPIFTSQALDERYYG
NLQGLNKAETAEKFGEEKVHEWRRSYSSRPPGGESLEDTKNRVIPYFQSRISDHIKRGQT
VLVAAHGNSLRAMVMALDNLEPDEVPGLELTTGVPIIYDFDDQGNVLEKTILT
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattaatcttactacgtcatggacaaagtctttggaatgctgctaataaattt
actgggtgggttgatgttcccttgagtgaaagaggacgtgcagaagcaacggtagcctct
tgtaaattacgggataaaggttataaaattgacgtttgttttaccagtttactaattaga
agtattgaaactgctgtcatttgtttaacggaatgtgaccaaatttgtggtgaaaaaatt
cctattattcaacatgattctgatgatcctgattggcacggttgggataaatatgctggt
aatttttatcaagaattacccatttttacttcccaagctttagatgagcgttattatggc
aatttgcaaggattaaataaagcagaaacagccgaaaaatttggtgaagaaaaagtccat
gagtggcggcgttcctactcctctcgtcctcccggtggggaaagtttggaagatacaaaa
aatcgagttattccctattttcaaagccgaatttcagaccatattaagcgaggacaaacg
gttttagtcgctgctcatggcaactccttaagggcgatggttatggcattagacaacctt
gaacccgatgaagttccagggttagaattgaccactggagtccccattatttacgatttt
gatgatcagggcaacgtattagaaaaaacaatattaacttaa

DBGET integrated database retrieval system