KEGG   Cyanothece sp. ATCC 51142: cce_1609Help
Entry
cce_1609          CDS       T00686                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    cce_1609
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    cce_1609
Enzymes [BR:cyt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     cce_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1618135..1620591)
Genome map
AA seq 818 aa AA seqDB search
MTVPNDLHVLKYDPMKTLFSLPNIPSCAWKRPIGQGWDNPYTVRYASNLDDGPWHGMPIG
GFGSGCIGRSPRGDFNLWHLDGGEHIFKSIPSCQFSIFEQPENGTAQAYALATEPPEDNT
LSRWAWYPTEKGTYSALYPCSWYQYEGVFQAEIYCEQFSPIIPDNYQETSYPIGVFEWTV
KNPTDKPITLSIMLTWQNIVGWFTNAIKSPEITVRDDGSPEYEYQPRWGHSTGNFNQWIQ
DNFRVGFILNRLQPHQQVQEGEGQICIASVTNPSVEVFYLGKWNPNGDGSEVWDHFAMNG
SLPDQEDETPAEPGEQIAAAMAIRFTVKPGRVKKIPFILAWDLPVTEFAQGIQYYRRYTD
FFGRNGQNGWAMVRTALKHSDVWREKIEEWQNPILNRDDLPDWFKMALFNELYLLTDGGT
LWTAASETDPIGQFGVLESMDYRWYESLDVRLYGSFGLLMLWPRLEKAVMEAFARAIPNS
DDTVRIIGYNQAEGIRKTKGATPHDLGAPNEHPWEKTNYTSYQDCNLWKDLGSDFVLQVY
RDFLLTGSDDIEFLWECWEAIPETLNYLKAFDLDNDGIPENSGAPDQTFDDWELRGISAY
CGALWIAALEAAIKIGEILLENAPQNPQLEPENYPKSIEKELDKYQQWLQQSRAIYHSTL
WNGEYYKLDSESGSDVVMADQLSGQFYARLLGLPDVVEQQYALSALKKVYEACFLKFQNG
KYGAANGMKPDGTPEDPNSTHPQEVWTGINFGLASFLIQMGMKDEALKLTEAVVKQVYEN
GLQFRTPEAITAVGTFRACHYLRAMAIWGVYYQFLVLF
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgactgttccgaatgaccttcatgttctaaaatatgatcccatgaagactttattttcc
ctcccaaacatcccttcttgcgcttggaaacgtcctatcggtcaaggatgggataacccc
tatacagtacgctatgcgagtaatttagatgacggtccttggcacggaatgcccatcggt
ggcttcggttccggttgtattgggcgatcgcctcgtggtgattttaacctctggcactta
gatgggggggaacatatttttaaaagtatcccatcttgtcagtttagtatttttgagcaa
cctgaaaatggcacagcacaagcttatgccttagccacggaacccccagaagataatacc
ctgtctcgttgggcttggtatcccacagaaaagggaacctattcggcactttatccctgt
agttggtatcagtatgaaggggtctttcaagccgaaatttattgtgaacagttttctcct
attatccctgataactatcaagaaaccagttatcccattggagtatttgaatggacggta
aagaaccctaccgataaacccattaccctcagtatcatgctcacttggcaaaatattgtc
ggctggtttaccaatgccattaaatctccagaaattactgttagggatgatggtagtcca
gagtatgaatatcaaccccgatggggtcatagtacggggaattttaatcaatggatacaa
gataattttcgggtgggttttattctaaatcgattacaaccccatcaacaagtgcaagag
ggagaaggacaaatctgtatcgccagtgttactaatcctagtgtagaggttttttatctg
ggaaaatggaatccgaatggcgatggttctgaggtttgggatcattttgctatgaatgga
tcattaccggatcaagaggatgaaacaccggccgaacctggagagcaaattgcagcagcg
atggccatccgtttcaccgttaaaccaggaagagtcaaaaaaattcccttcattttagcc
tgggatttgcccgtaacagaatttgcccaagggattcaatattatcgtcgttatactgat
ttttttggtcgtaatggacagaatggttgggcaatggttagaaccgctttaaaacattcg
gatgtgtggcgtgaaaaaatagaagaatggcaaaatcctatcttaaatagagacgattta
ccagactggtttaagatggctttgtttaatgaattatatttattaactgatggggggacc
ctttggacggcagcttctgaaactgatcccatcggacaatttggtgtcttagaatcgatg
gattatcgttggtatgaaagtttagatgtcagattatatggatcgtttggcttattgatg
ttatggcctcgcttagaaaaagccgttatggaggcctttgcacgggcaattcctaacagt
gatgatactgttagaattattggttataaccaagctgaaggaatcaggaaaaccaaaggt
gcaacgccccatgatttgggtgcgcctaacgaacatccttgggaaaaaactaattataca
agctatcaagattgtaatctttggaaagatttaggcagcgattttgttttacaagtttat
cgagattttctgttaacgggttcggatgatattgaatttttatgggaatgttgggaagcg
attccagaaacgttaaactatctcaaagcatttgatttagataatgatggtattcccgaa
aattctggcgcaccggatcagacatttgatgactgggaattacggggaattagtgcttat
tgtggggcgttatggattgctgctttagaagctgctattaaaataggagaaatcttatta
gaaaatgctccccaaaatccacaattagaacctgaaaattatcccaaatctattgaaaaa
gaactagataaatatcagcaatggttacaacaatctcgtgctatttatcattccacttta
tggaatggggaatactataaactggatagtgaaagtggttccgatgtggtaatggcggat
caattatcaggtcaattttacgctcgtttattaggtttacccgatgtggttgaacagcaa
tatgcactatctgctttaaagaaggtttatgaagcttgtttcttgaagtttcaaaacgga
aaatatggggctgccaatggtatgaaacctgatggaaccccagaagatccgaactcaacc
catccccaagaagtttggacaggcattaattttggtttagcctctttcctaatacaaatg
ggaatgaaagatgaagctttaaaattaactgaagctgtggttaaacaagtgtatgaaaat
ggcttacagtttcggactcctgaagcgataaccgccgtcggaacctttagagcgtgtcat
tatttaagagcgatggctatctggggagtttactatcagttcttggttttattttag

DBGET integrated database retrieval system