KEGG   Cyanothece sp. ATCC 51142: cce_1619Help
Entry
cce_1619          CDS       T00686                                 

Gene name
cysQ
Definition
ammonium transport protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    cce_1619 (cysQ)
Enzymes [BR:cyt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     cce_1619 (cysQ)
Transfer RNA biogenesis [BR:cyt03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    cce_1619 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1631584..1632441)
Genome map
AA seq 285 aa AA seqDB search
MTQTQKLEEIEVIARSVGWGAANILSSYYQGEGDLKVNEDKKDGPVTAADLAANRYILEK
LKAVFQEDTFGYLSEETHKGTEPIAKDWVWIIDPLDGTRDFIDKTGEYALHIALAYQGRP
MVAVVAIPEAQKIYYASKGHGTFVETKDGKITPIKVSERNKLEDLYLVVSRTHRDDRFQA
LIEALPLKDKIYMGSVGGKIATLLEKTSDIYISLSGKSAAKDWDFAAPELILTEAGGKFT
HENGDPIIYNRGDVRQWGCLIASNGHCHEELCEKATELLAKIDNQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacccaaaaattagaagaaatcgaagttattgcccgttctgtgggttggggg
gctgctaatatcctcagttcctattatcaaggagaaggggatttaaaggttaatgaagat
aaaaaagatgggcctgtaactgctgctgatcttgctgcgaatcgttacattttagaaaaa
ttaaaggcggtttttcaggaagatacctttggttatttgagtgaagaaacccataaagga
accgaacccattgctaaagactgggtttggattattgatcctcttgatggtaccagagat
tttattgataaaactggcgaatatgccttacatattgccctcgcttatcaaggtcggccg
atggtggctgtggttgctattcctgaagcccaaaaaatttattatgcgagtaaaggacac
ggaacttttgttgaaaccaaagacggtaaaattacccccattaaagtatcagaacgcaat
aaattagaagacttatacttagtggtgagtcgtactcatagagacgatcgctttcaggct
ttaattgaagctttacccctaaaagataaaatttatatgggcagtgttggggggaaaatt
gccactttattagaaaaaacttccgatatttatatctctctttctggtaaatctgcggcc
aaagattgggactttgctgcacccgaattgatcttaaccgaagcaggcggaaaatttacc
cacgaaaatggcgatcccattatttataatcgaggagatgtccgtcaatggggttgtttg
atcgctagtaatggtcattgtcatgaagaattatgtgaaaaagccaccgaacttttagct
aaaattgataatcaataa

DBGET integrated database retrieval system