KEGG   Cyanothece sp. ATCC 51142: cce_1619Help
Entry
cce_1619          CDS       T00686                                 

Gene name
cysQ
Definition
ammonium transport protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cyt00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1631584..1632441)
Genome map
AA seq 285 aa AA seqDB search
MTQTQKLEEIEVIARSVGWGAANILSSYYQGEGDLKVNEDKKDGPVTAADLAANRYILEK
LKAVFQEDTFGYLSEETHKGTEPIAKDWVWIIDPLDGTRDFIDKTGEYALHIALAYQGRP
MVAVVAIPEAQKIYYASKGHGTFVETKDGKITPIKVSERNKLEDLYLVVSRTHRDDRFQA
LIEALPLKDKIYMGSVGGKIATLLEKTSDIYISLSGKSAAKDWDFAAPELILTEAGGKFT
HENGDPIIYNRGDVRQWGCLIASNGHCHEELCEKATELLAKIDNQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacccaaaaattagaagaaatcgaagttattgcccgttctgtgggttggggg
gctgctaatatcctcagttcctattatcaaggagaaggggatttaaaggttaatgaagat
aaaaaagatgggcctgtaactgctgctgatcttgctgcgaatcgttacattttagaaaaa
ttaaaggcggtttttcaggaagatacctttggttatttgagtgaagaaacccataaagga
accgaacccattgctaaagactgggtttggattattgatcctcttgatggtaccagagat
tttattgataaaactggcgaatatgccttacatattgccctcgcttatcaaggtcggccg
atggtggctgtggttgctattcctgaagcccaaaaaatttattatgcgagtaaaggacac
ggaacttttgttgaaaccaaagacggtaaaattacccccattaaagtatcagaacgcaat
aaattagaagacttatacttagtggtgagtcgtactcatagagacgatcgctttcaggct
ttaattgaagctttacccctaaaagataaaatttatatgggcagtgttggggggaaaatt
gccactttattagaaaaaacttccgatatttatatctctctttctggtaaatctgcggcc
aaagattgggactttgctgcacccgaattgatcttaaccgaagcaggcggaaaatttacc
cacgaaaatggcgatcccattatttataatcgaggagatgtccgtcaatggggttgtttg
atcgctagtaatggtcattgtcatgaagaattatgtgaaaaagccaccgaacttttagct
aaaattgataatcaataa

DBGET integrated database retrieval system