KEGG   Cyanothece sp. ATCC 51142: cce_1639Help
Entry
cce_1639          CDS       T00686                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    cce_1639
Enzymes [BR:cyt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     cce_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1653411..1655294)
Genome map
AA seq 627 aa AA seqDB search
MTFHSNQRIPYYPQPDYTQPLLEITSEIREKLLSRLSVLYGKVEAKNCIEELERLLKVHY
AYKPPERIQAEQEFELSDCFSQQDIILITYGDLLISEHLTPLKTLQEFLKQYVKLYDVFS
ILHLLPFFPYSSDRGFSITDYRSVDPKLGAWKDIQAIGESFRLMFDGVFNHISSQSHVFQ
EVLNGNPDYKNFATIYHSPDELTSKQRQILVRPRTSDILSEYQSIDGKIWVWTTFSPDQI
DLNYRNPKVLLFMIDTFLLYVRRGASLIRLDAVTYLWDEPGTNCVHLEQTHEVIKLLRDI
LDIVDPKVVLVTETNVPHEENISYFGNGSDEAQIIYNFALPPLVLYTFYKEDSTAISRWA
ESLDYPTETTNFLNMLDTHDGIGLMGVKNILTPSQINFIIEQAREHGALISYKTGEEGKD
EPYEINSTWFSAINFDNGTESIELQVKRFIASRSLALALRGIPAIYFHGLIGTRNDLEAV
IKTKSKRDINRTTLVEEDLKTNLLKKDSKLSKIVEQLGHLLEIRSRQVAFHPNGEQKILE
ISQKVFSIFRISPNKKEHILAITNISNQAETINIDLDDLDLKQSQWYDLVNRRGLTTKEQ
QLCINLLPYDVVWLIPLVELERMIESH
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcactcaaaccaaagaattccctattatccacaaccagactatactcaaccg
ttattagaaattacgtcagaaattcgagaaaaactattgtctcgtttatctgtgctttac
ggaaaggttgaggcaaaaaactgtattgaagagttagaaagactgttaaaagttcattat
gcttataaacctccagaaaggattcaagctgaacaagaatttgaacttagtgattgtttt
agtcagcaagatattattctgattacttatggagatttattgattagtgaacatctgaca
ccccttaaaactttacaagaatttctaaaacaatatgtcaaactctatgatgtttttagt
atcttacatcttttaccgtttttcccttattcatcggatcgagggttctctattactgat
tatagaagtgtcgatccaaaactgggtgcctggaaagatattcaagcaataggtgaatcg
tttcgccttatgtttgatggggtatttaatcatatctcttctcaaagtcatgtgtttcaa
gaggtgttaaatggaaaccccgactataaaaattttgcaactatttatcattcacccgat
gaattaacctctaaacaaagacaaatcttagttcgtcctcgaacctccgatattctctca
gaatatcaatcaatagacggtaaaatttgggtttggactactttttcgccggatcaaatt
gatctcaattatcgtaacccgaaagtattgctttttatgattgatacttttctactttat
gtcagacgaggagcttctttaattcgcttagatgcagtgacctatttatgggatgaacca
ggaactaactgtgttcatttagaacaaacccacgaggttattaaactattaagagatatt
ttagatattgttgatcctaaagttgttctagtaacagaaaccaatgtgcctcatgaagaa
aatatatcttactttggtaatggttctgatgaagcacaaattatctataatttcgctctc
cctcctttagttctttatactttttataaagaggatagtacagccatttctcgatgggct
gagtctttagactatcctaccgaaacaacaaactttttaaatatgttggatactcatgat
ggaattggtttaatgggagttaaaaatattctcaccccttcacaaattaattttattatt
gaacaagcaagggaacatggggctttaatttcctataaaactggagaagaaggaaaagat
gaaccctacgaaattaattctacttggtttagtgcgattaactttgacaatggaacagaa
tctatcgaattacaagtcaaacggtttattgcgtctcgtagtctggctttagctttaaga
ggaattcctgctatttattttcatggtttaataggtactcgtaacgatttagaagcagtc
atcaaaactaaatcgaagcgagatattaaccgaaccactctggttgaagaagacctaaaa
acaaacttactcaaaaaagattcaaaactttccaaaattgtcgagcaacttggacattta
ttagaaattcgcagcagacaagtggcatttcatcccaacggcgagcaaaaaatcttagaa
atttctcaaaaagtgttttcaatttttcgtatttcacccaataaaaaggaacatattcta
gctattactaatattagtaaccaagcagaaactatcaatattgatcttgatgatctcgat
ctcaaacaaagtcaatggtacgatttagtcaatagacggggattaaccaccaaagaacaa
caactctgcatcaacttacttccctacgatgttgtctggttaattcccctggtagagtta
gaacgcatgatcgaaagccattaa

DBGET integrated database retrieval system