KEGG   Cyanothece sp. ATCC 51142: cce_1659Help
Entry
cce_1659          CDS       T00686                                 

Gene name
hemB2
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00860  Porphyrin and chlorophyll metabolism
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
cyt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cce_1659 (hemB2)
Enzymes [BR:cyt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     cce_1659 (hemB2)
Exosome [BR:cyt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cce_1659 (hemB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACB51009
CyanoBase: cce_1659
CYORF: cce_1659
UniProt: B1WYJ2
Position
complement(1670882..1671877)
Genome map
AA seq 331 aa AA seqDB search
MMLMFPINRPRRLRQNDHLRRMVRETILTTNDLIYPLFAVPGSSVAKEVVSMPGVYQLSI
DKIVDEAKEVYDLGIPAIILFGIPEEKDTEATGAWHDHGIVQQAATAVKEAIPDLVVIVD
TCLCEYTSHGHCGYLEVGDLTGRVLNDPTLELLKKTAVSQANAGADIIAPSGMMDGFVQA
IREGLDEAGFNHIPILSYAAKYASAYYGPFRDAADSSPQFGDRRTYQMDPGNAREALKEV
DLDIAEGADMLMVKPALSYMDIIWRVKEMTDLPVAAYNVSGEYSMVKAAALKGWIDEKKV
TLETLTSFKRAGADLILTYHAKDAARWLQEG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcttatgtttcctattaaccgtcctcgtcgtttgcgtcagaatgatcacctccgt
cgtatggtgcgtgaaaccatattgaccactaatgatctaatttaccctttatttgcggtt
ccaggtagtagtgtcgccaaagaagtcgtttctatgccgggggtttatcagctatctatt
gataagatagtcgatgaagccaaggaagtctatgatctcggtattcctgccattatttta
tttggtattcctgaagagaaggacacagaggcgaccggtgcatggcatgatcatggtatt
gtgcaacaagcagctacagccgttaaagaggctattcctgatctagtggttattgtggat
acttgtttatgtgagtataccagtcatggtcactgtggttacttggaagtcggtgactta
acgggaagagtattaaacgatcctaccttagaattattaaagaaaacggctgtttctcag
gctaacgcaggggccgatatcattgcaccttcggggatgatggatggttttgtacaagcc
attcgagaagggttagacgaggctggatttaaccatattcctatcttatcctatgctgcc
aagtatgcctcagcttattatggaccgtttcgggatgctgcggactcttctcctcaattt
ggcgatcgccgtacctatcagatggaccctggaaatgctagagaagcgttaaaagaggtg
gatctcgacattgcagagggggctgatatgttgatggttaaacctgctttatcttacatg
gatattatttggcgggtcaaggaaatgacggatcttccggttgctgcttataatgtttcg
ggggaatattcgatggtgaaagctgctgctttaaagggttggatcgatgagaagaaagtt
actttagaaactcttaccagttttaagcgtgccggtgctgatttaatcttaacttatcat
gctaaagatgcagcccgttggttacaagaaggatag

DBGET integrated database retrieval system