KEGG   Cyanothece sp. ATCC 51142: cce_1861Help
Entry
cce_1861          CDS       T00686                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    cce_1861
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     cce_1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1884959..1885915
Genome map
AA seq 318 aa AA seqDB search
MQKLVFKYFMSIVVFGSINMDMIAQTPRFPQPGETITGTHFITLPGGKGANQAVATAKLG
RSTYFVGRVGGDSLGRDLLKKLETFDINTQGVLIDKNTSSGVAMITVETSGENSIIVIPG
ANGNINESDVIRLEKILLKTSLLLLQLEIPLKAVEIAALEAKKLGVTVMLDPAPAPEKIP
DSLYPLIDIITPNQTEAAKLVGFPVSDTETIKKAAEELLQKGVKIVIIKLGQKGAFYATE
NEEGFVAPTAVKAIDTVGAGDGFNGGVAAALDRGLSLKEALKWGAIVGALTTTEEGAQTA
LPDLETVEQLINNPLSSL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaattagttttcaagtattttatgagtattgtagttttcggtagcattaatatg
gatatgattgcccaaacccctcgctttcctcaaccgggggaaaccattacaggcactcac
tttatcactttaccaggaggaaaaggggcaaaccaagcggttgcaacggcaaaattaggt
cgttcaacttactttgtgggacgggttgggggtgatagtttagggagagatttattaaaa
aaattagaaacatttgacatcaatactcagggagttttgattgataaaaatacctcttca
ggggtagcgatgatcacagtagaaacatcaggagaaaatagcattattgttattcctggg
gctaatggtaacattaatgagtctgatgttattcgtttagagaaaattctcttgaaaacc
agccttttattattacaattagaaattcccttaaaagcagtagaaatagcagccctagaa
gcaaaaaaattaggggtgacagtcatgttagatccagcaccagcaccagagaaaattcct
gatagtttatatcctctaattgatattattacccccaatcaaaccgaagcagcgaaatta
gtcggtttccctgtgtctgatacagaaaccattaaaaaagcggctgaggaattattgcaa
aaaggagtcaaaattgtcattattaaactagggcaaaaaggagccttttatgccacagaa
aacgaggaaggatttgtcgctcctaccgccgttaaagccattgatacagtgggggcagga
gatggatttaatgggggagttgctgctgctttggatcggggtttatcccttaaagaagcc
ttgaaatggggagctattgtaggagctttaactaccacagaagaaggcgcacaaactgct
ttacccgacttagaaaccgttgaacaattaataaataaccctctttcatcactctag

DBGET integrated database retrieval system