KEGG   Cyanothece sp. ATCC 51142: cce_2016Help
Entry
cce_2016          CDS       T00686                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00010  Glycolysis / Gluconeogenesis
cyt00620  Pyruvate metabolism
cyt00640  Propanoate metabolism
cyt00680  Methane metabolism
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
cyt01120  Microbial metabolism in diverse environments
cyt01130  Biosynthesis of antibiotics
cyt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_2016 (acs)
   00620 Pyruvate metabolism
    cce_2016 (acs)
   00640 Propanoate metabolism
    cce_2016 (acs)
  Energy metabolism
   00680 Methane metabolism
    cce_2016 (acs)
Enzymes [BR:cyt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     cce_2016 (acs)
Lipid biosynthesis proteins [BR:cyt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   cce_2016 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACB51366
CyanoBase: cce_2016
CYORF: cce_2016
UniProt: B1X1D7
Position
2048689..2050686
Genome map
AA seq 665 aa AA seqDB search
MLRSIVMVASSEKNNIESVLQEKRVFNPPADFATNAHIKSLQQYEELYEKAKNDPETFWA
ELAEQELYWFEKWDQVLDWNPPTAKWFVNGKLNMSYNCLDRHLTTWRRNKAAIIWEGEPG
DSRTLTYGELHREVCQFANVLKDMGVQKGDRVGIYMPMVPEAAIAMLACTRIGAPHSVVF
GGFSAEALRDRLEDAEAKVVITADGGFRKDKIVPLKIEVDQALENGASSVEKVIVVQRTK
QDVTMREGRDYWWHDLQKDASPKCDAEVMDSEDPLFILYTSGSTGKPKGVVHTTGGYNLY
THMTTKWIFDLKDTDVYWCTADVGWITGHSYIVYGPLSNGATSLMYEGVPRPSNPGCFWD
VVEKYGVNVFYTAPTAIRAFMKMGEELPNARDLSSLRLLGTVGEPINPEAWMWYHRVIGG
EKCPIVDTWWQTETGGIMITPLPGATPTKPGSATRPFPGIIADVVDKDGNPVPNNAGGYL
VIKHPWPSMLRTVYNNPERFQKTYWDPIPEVEGKPVYFAGDSARKDENGYFWIMGRTDDV
MNVSGHRLGSMELESALVSHPAVAEASVVGVPHEIKGEDIYAFVTLKDNYSPSDELNKEL
KQHVVTKISAIARPGTIQFAEALPKTRSGKIVRRFLRQIAAGQDIVGDKSTVVDPSVLDQ
LREKG
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaggtctatcgttatggttgcatcctccgaaaaaaataacattgaatctgtctta
caagaaaaacgggtttttaaccctccggctgactttgctaccaacgcacatatcaaaagt
cttcaacaatatgaagaactatatgagaaggccaaaaacgatcccgaaaccttttgggca
gaactagcagaacaagaattatattggttcgagaaatgggatcaagttctagactggaac
ccccccaccgccaaatggtttgttaatggcaaactgaatatgtcctataactgcctcgat
cgccatcttaccacttggcgacgcaacaaagcagctattatctgggaaggagaacccggc
gactctcgcaccctcacctacggggaactacaccgagaagtgtgtcagtttgccaatgtg
ttgaaagacatgggagtgcaaaaaggcgatcgcgtgggtatttatatgccgatggttccc
gaagctgcgatcgctatgttagcctgtactcggatcggtgcgccccatagtgtcgtattt
ggtgggtttagtgccgaagcattacgcgatcgcttagaagatgcagaggctaaagttgtc
attactgcggatggggggtttcgcaaagataagatcgttcccctgaaaatagaagtggat
caagccctcgaaaatggggcttctagcgtcgaaaaagtgatcgttgtacaacggaccaaa
caagatgttaccatgcgcgaaggacgtgattattggtggcacgatctccaaaaagatgcc
tctcctaaatgcgatgcagaagtaatggatagcgaagatcccctattcattctctatacc
agtggtagtacaggaaaacctaaaggggttgtccataccaccggcggttataacctttat
acccacatgaccacaaaatggatctttgatctcaaagacaccgatgtttattggtgtact
gccgatgtgggttggatcacgggacacagttacattgtttatggtcctctttctaatggt
gcaacatctttgatgtatgaaggggttcctcgtccctctaaccctggttgtttttgggat
gtggtagaaaaatacggggtcaatgtcttttatactgcacctacagctatccgtgcattt
atgaagatgggagaagaattacccaacgccagggatctctcatccttgcgtttgttggga
accgtcggggaacccatcaaccccgaagcttggatgtggtatcaccgagttattgggggt
gaaaaatgtcctatcgttgatacttggtggcaaaccgaaaccggtgggatcatgattaca
ccgttacctggggccacacccaccaaaccgggatcagcgactcgtcctttccctggtatt
attgccgatgtggtggacaaagacgggaaccccgttcccaacaatgccggaggatatctc
gttattaaacatccctggcccagtatgttacgcactgtttataataaccctgaacgcttc
caaaagacctattgggaccccattcctgaagttgaagggaaaccggtctatttcgctggt
gatagtgcgcggaaggatgaaaacggctatttttggattatgggccgcaccgatgacgtg
atgaatgtctccggacaccgtttgggttcaatggagttagagtctgcgttagtgtctcat
cctgcagttgctgaagcgtctgtggttggggttccccatgagatcaaaggggaagatatt
tatgcttttgttaccttgaaggataattatagccccagtgacgagttaaataaggagtta
aaacagcacgtcgtaactaaaattagtgcgatcgctcgtccgggtactatacagtttgct
gaagcattacctaaaacgcgatcgggtaaaattgtacggcgtttcttacgtcaaatagct
gccggtcaagatattgtaggagataagtctacggtagttgatccaagtgttttggatcag
ttgagagagaagggttaa

DBGET integrated database retrieval system