KEGG   Cyanothece sp. ATCC 51142: cce_2130Help
Entry
cce_2130          CDS       T00686                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00260  Glycine, serine and threonine metabolism
cyt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
cyt01130  Biosynthesis of antibiotics
cyt01230  Biosynthesis of amino acids
Module
cyt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cce_2130 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cce_2130 (trpA)
Enzymes [BR:cyt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cce_2130 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG NanE Ribul_P_3_epim PcrB
Motif
Other DBs
NCBI-ProteinID: ACB51480
CyanoBase: cce_2130
CYORF: cce_2130
UniProt: B1WNQ1
Position
2166062..2166856
Genome map
AA seq 264 aa AA seqDB search
MTSVSECFQSLRDRKQCGLIPFITAGDPDLETTAKALRVLDASGADLIELGVPYSDPLAD
GPVIQAAASRALRRGVKLEDVLNIVKGVQGDIKAPIILFSYYNPIFYRGIEAFLEQIKSA
GVKGLVVPDLPLEEAETLLKPAAEMGIEVTLLVAPTSPIERIKAIAHQSQGFIYLVSVTG
VTGMRTQVATRVEDLLKSLRNTTDKPIGVGFGISEPEHALQVKNWGSDAVIVGSACVKRL
AQGTPEEGLKAVGEFCQRLKQAIQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggtttctgagtgttttcaatccctacgcgatcgcaaacaatgcggacttatt
cccttcattactgcaggtgatccggatcttgagacaacagcgaaagcgttacgggttctc
gatgcgtcaggggctgatcttattgaactcggtgtcccttattctgatccgttggccgat
ggacctgtaatccaagcggccgctagccgtgctttacgtcgaggggtaaagttagaagat
gtcttaaatattgtcaaaggggttcaaggagatattaaagctcctattattctctttagc
tactataacccgattttttatcgtggtattgaagctttcttagaacaaattaagtctgct
ggggtcaaagggttggtggttcctgatttgcccctcgaagaagcggaaacgttattgaaa
ccggctgctgaaatgggcattgaagtgactttattagttgcccccaccagtcctatcgaa
cggattaaggcgatcgctcatcagtctcaagggtttatttatctcgtcagtgttacaggg
gtaactggtatgagaacccaggtagctactagagtcgaagacctgctgaaaagtcttcgt
aatacaacggataagcccattggggtcggatttggcatttctgaacctgaacacgcctta
caggtgaaaaattggggatcggatgcggtcattgtgggcagtgcttgcgtcaaaaggttg
gctcaaggaaccccagaagaaggattaaaagcagtgggcgaattttgtcagcgtcttaaa
caagctattcaatag

DBGET integrated database retrieval system