KEGG   Cyanothece sp. ATCC 51142: cce_2130Help
Entry
cce_2130          CDS       T00686                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyt01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cyt00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cyt00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2166062..2166856
Genome map
AA seq 264 aa AA seqDB search
MTSVSECFQSLRDRKQCGLIPFITAGDPDLETTAKALRVLDASGADLIELGVPYSDPLAD
GPVIQAAASRALRRGVKLEDVLNIVKGVQGDIKAPIILFSYYNPIFYRGIEAFLEQIKSA
GVKGLVVPDLPLEEAETLLKPAAEMGIEVTLLVAPTSPIERIKAIAHQSQGFIYLVSVTG
VTGMRTQVATRVEDLLKSLRNTTDKPIGVGFGISEPEHALQVKNWGSDAVIVGSACVKRL
AQGTPEEGLKAVGEFCQRLKQAIQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggtttctgagtgttttcaatccctacgcgatcgcaaacaatgcggacttatt
cccttcattactgcaggtgatccggatcttgagacaacagcgaaagcgttacgggttctc
gatgcgtcaggggctgatcttattgaactcggtgtcccttattctgatccgttggccgat
ggacctgtaatccaagcggccgctagccgtgctttacgtcgaggggtaaagttagaagat
gtcttaaatattgtcaaaggggttcaaggagatattaaagctcctattattctctttagc
tactataacccgattttttatcgtggtattgaagctttcttagaacaaattaagtctgct
ggggtcaaagggttggtggttcctgatttgcccctcgaagaagcggaaacgttattgaaa
ccggctgctgaaatgggcattgaagtgactttattagttgcccccaccagtcctatcgaa
cggattaaggcgatcgctcatcagtctcaagggtttatttatctcgtcagtgttacaggg
gtaactggtatgagaacccaggtagctactagagtcgaagacctgctgaaaagtcttcgt
aatacaacggataagcccattggggtcggatttggcatttctgaacctgaacacgcctta
caggtgaaaaattggggatcggatgcggtcattgtgggcagtgcttgcgtcaaaaggttg
gctcaaggaaccccagaagaaggattaaaagcagtgggcgaattttgtcagcgtcttaaa
caagctattcaatag

DBGET integrated database retrieval system