KEGG   Cyanothece sp. ATCC 51142: cce_2231Help
Entry
cce_2231          CDS       T00686                                 

Gene name
dfrA
Definition
dihydrokaempferol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cyt  Cyanothece sp. ATCC 51142
Brite
Enzymes [BR:cyt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     cce_2231 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2268791..2269798)
Genome map
AA seq 335 aa AA seqDB search
MTIKAFVTGGTGFIGANLVRLLLKEGYEVRALVRPQSNLDNLKELDLEIIKGDLNDINLV
EKIRGCHVLFHVAAHYSLYQSDQDKLYESNVLGTRSILNAAKQANIERIIYTSSVAAIGV
GKPGQIVNESHQSPVNELVGHYKKSKYWAEQEAKKAIINGQDIVIVNPSTPIGPLDIKPT
PTGDIILRFLRRQMPAYVNTGLNLIDVRDVAQGHLLALEKGKTGERYILGNKNLSLKALL
EELSLLTGLKAPQQTLPLWLPLTVAWVEETLLSPLGKKPSIPIDGVKMSKQPMYYDPSKA
INELGLPSSPIENALQDAITWFTNNGYVETNSINR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaaagcctttgttactggaggaaccggatttattggcgcaaacttagttaga
ctcttattaaaagaaggctatgaagtgcgggctttagttcgccctcaaagtaatttagat
aacctcaaagaattagacctcgaaattattaaaggggatctcaacgatatcaatttagtg
gaaaaaataagaggatgccatgtgctatttcatgtggctgcacactattctttatatcag
tctgatcaagataaattatatgagagtaatgtgttaggaactcgttctattttaaacgca
gctaaacaagcgaatattgaacgcattatttacaccagttccgttgctgcgatcggtgtg
ggaaaaccaggacaaatcgttaacgaaagccatcaaagtcctgttaatgaattggttgga
cattacaaaaaatcaaaatattgggctgaacaagaagctaaaaaagccatcatcaatggg
caagatattgttatcgttaatcccagtacccccattggaccactcgatattaaacccact
cccacaggagacattattttacgttttttacgtcgtcaaatgccagcttatgtcaatact
gggttaaatcttattgatgtgcgagacgtagcgcaaggtcatctgttagccttagaaaaa
gggaagacgggggaacggtatattttaggtaacaaaaacctcagtttaaaagccttatta
gaggaattatccctactaacagggttaaaagcccctcaacaaaccttacccctttggtta
cctttaaccgtggcttgggtagaagaaacgttattatctcctttgggtaaaaaaccgtca
attcctattgatggggtcaaaatgtctaaacaacctatgtattacgatccatctaaagcg
attaatgagttaggcttgccatcttctcccattgaaaatgcgttacaagatgctattact
tggtttaccaataatggatatgttgagactaattcaattaatcgttaa

DBGET integrated database retrieval system