KEGG   Cyanothece sp. ATCC 51142: cce_2232Help
Entry
cce_2232          CDS       T00686                                 

Definition
two-component sensor histidine kinase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    cce_2232
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    cce_2232
Enzymes [BR:cyt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     cce_2232
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     cce_2232
Two-component system [BR:cyt02022]
 CheA family
  CheA-CheYBV
   cce_2232
Bacterial motility proteins [BR:cyt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    cce_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2270018..2274517)
Genome map
AA seq 1499 aa AA seqDB search
MPMSSLAKPENEKFYIIGIGASAGGVQALESFFNSLPDNPNGAFVVVQHLSPNHRSMMTE
ILQRQTTLPVEQVQDHILLEPAKVYVLPPRRTLILEDRRLRLLEEPPNSPRNIIDRFFQS
LVDGWGERMIAILLSGTGHDGTEGLQSVSRAGGIALVQSPETAQFTSMPSSAIPSGLVDE
ILSPQDLAQTVYELIRFSDNFPTASLQDENLIDPNQLQEILEILAEKEDIDFSHYKVSTL
SRRILHRCALTRQENITQYIERLETSEQEQKLLRQDLLIGATCFFRDPQVWELLKEQVLP
EQIGKLKPDEQLRIWISACATGEEAYSMAIIVDELLQTIDKTVQVKIFATDLDSKALEVA
AEGTYPDTIGNDISPERLKRYFEDQGNQYRVKPSLREMLIIAPQDLTKNAGFSKIHLVSC
RNVLIYMQSPLQYQVLRLLHFALKPQGTLMLGTSETLGNMRDEFTPISAKWKIFQKRRES
SLSSLMITRPSLPSTIKSSVSTKTRQQRFDTILAGLLKLCLDDRQITALLVGADNKLVQI
FHNSAQLLEHSLGVMSLDVVEQVHPALKLPLSTALHRTRRRNEELALYTGIKIEKKGEPL
NVTLRVTPNKNGGDKEQILVVFEIETSPTASVQPSRFDVGEEAAQQISELEQELQQTREN
LQVTIEELETANKEQQATNEELLASNEELQSTNEELQSVNEELYTVNAEHQSKIQELTQL
NTDIDNLLRSTDIGVIFLDRQFNIRKFTPAAIRAVNIKPSDVGRPLTDLTNNLHCPNLIN
IVQQVARTEEPYEQEVAIAPSDEYVLMRVHPYLQDDKDSDGIVMTFVQVNELKQVQQHLK
QTNLLLENLYEASPAGLCLFDQGLKFIRVNPALARINGISIEGHLGKTLYDIAPQLAEYL
EGILRQVIDTGEAICNIEVRGKMPATSEIERCWIASYYPVDFLNDGRGVGAVVVEITQRV
QAEEALRHSQARLQEAQRLAKVGNWELKHEDNLTLETAQPDCSKELSDIYQFDPQQSCFS
LEDILHCHPPADRKALENAFQLLIFDGIPFSLDVELNVSEQEVHCLNVIGQVIRDKDGQI
LKFYGTVMDITERKRIEQELVRRNKALEEAIAVAQVADSANQAKSEFLANMSHEIRTPIN
SIMLVSQLLEGTNLDTQQKKLLQTLNNNSNHLLNLINKILSLSKLESRTLELEHRPFHLN
QMFQELSHTFTPQAQSKAIGLTFTIASEVPDVLMGDDFRLQQVFSNLISNAIKFTFSGQV
TVTATLPNDTVSQSSPVTLYFTVQDTGIGIDPTKQDSLFQPFVQADTSTTRQFGGTGLGL
TICRRIVQSMKGEIGLDSRVGKGSTFWVKIPFALGDGIRLPETAETNNPDPERQATAPTA
LKILLVEDYEDNRFLMLMLLENLGYQADWVTNGQEFLDQTEEQEYDLVFLDCQMPILDGY
EAIQRFRQREGASNHTVVIGITAHAMEGDRQKCLDAGMDDYLSKPIIMENLVNLLEKWS
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
ttgcccatgtcatcattagcaaaacctgaaaatgaaaagttttatattattggtattggt
gcctcagccggtggagtacaggcattagaatctttttttaatagtttgcctgataatcct
aatggggcgtttgtggtagtgcagcacctatcccccaatcaccgcagcatgatgacagaa
attttacaacggcaaaccaccctacccgtcgagcaagtacaagatcacatcctacttgaa
ccagcgaaagtctatgtactaccccctcgcagaaccctgatactcgaagaccgacggctg
cgtttattagaagaaccgcccaattcaccacgaaacatcatcgatcgcttttttcagtcc
ctggtggatggttggggggagcgaatgatcgccattttgctctcaggaactggccacgac
ggcaccgagggactacagtccgtcagtcgtgccggtggcatcgccttggttcagtcccca
gaaacggcacagtttaccagtatgccctccagtgccattccttcgggtttagtggatgaa
attctctcaccccaggatcttgcccagaccgtctatgaactgattcgcttttccgataac
tttcccaccgccagcttgcaagacgagaatcttattgatcccaaccaactccaagaaatt
ctagaaattttagccgaaaaagaagacatcgatttttcccactacaaagtgagtaccctg
agtcgtcgtattcttcatcgttgcgccctgactcgccaagaaaacattactcaatatatc
gaacgattagaaacctctgaacaagagcaaaagctactacgacaagacttattaattggt
gcaacctgcttttttcgagatcctcaagtttgggaactgctcaaagagcaagtgttaccg
gagcaaattggcaaattaaagccagacgaacaacttcgtatctggatttcagcttgtgcc
acaggagaagaagcctattcaatggccatcattgtcgatgaactcctgcaaaccatcgac
aagacagttcaggtgaagatttttgccacggatctcgatagcaaagccctagaagttgct
gctgagggaacctatcccgatactattggcaatgatatttccccggaacgcctaaaacgt
tacttcgaggatcaaggaaaccaatatcgtgtcaaaccatccctgcgagaaatgctgatc
attgccccccaagacctcacaaaaaatgcaggtttctccaaaattcacctggtcagttgt
cggaatgttctcatttatatgcagtctccactacagtatcaggtgttgcgactgctacac
tttgccctcaagccccaaggaaccctaatgttagggacttctgaaaccctaggtaatatg
agggacgaatttactcccattagtgccaagtggaaaatttttcaaaaacggcgagagtca
tctctgtcttctctgatgattactcggccttcccttccctcaaccatcaaatcttctgtc
tctaccaagactcgtcagcaacgatttgatactatcttagccggattactcaaactctgt
ttagatgatcgtcaaattacggctttgttagtgggcgctgacaacaaattggtgcagatt
tttcataactcagcccaactcctagagcattccctgggcgtaatgagtcttgacgtagtt
gagcaagtccatccggccctaaagttaccgctgagtaccgccctccatcgaacccgtcgt
cgtaacgaagagttggcactatacaccggcattaagatagaaaaaaaaggggaaccattg
aacgttaccctgcgagttactcccaacaagaatggtggtgataaagagcaaattttggtg
gtgtttgaaatagaaacttcccctactgcttcagtacagccgtcgagatttgatgtagga
gaagaagcagcccaacaaattagtgagttagaacaggaactccagcaaacccgtgaaaat
ttgcaagtcactatcgaagaactcgaaaccgccaacaaagaacaacaggccaccaacgaa
gaacttctcgcctctaacgaagagttgcaaagtaccaacgaagaactacaatcagtcaac
gaagaactatatacagtcaacgctgaacatcagtccaaaattcaagagctaactcaactg
aacaccgatattgataacttactgcgaagtaccgacatcggtgtcatttttctcgataga
caattcaatattcgcaagttcaccccagcagcgatacgggctgttaacatcaagccttcc
gatgtcggccgtcccctcacggacttaaccaacaacctccattgtcccaacttgatcaac
attgtgcagcaagtggcaagaaccgaggaaccctacgaacaggaagtggccattgcccca
tccgatgagtatgtattgatgcgagttcatccctatctccaggacgacaaagacagtgac
ggcatcgttatgacctttgtgcaggtgaatgagctaaagcaagtgcaacaacatctaaaa
cagactaacctacttctcgaaaatctctacgaagctagtccagccggactttgcttgttt
gaccaagggttaaaatttattcgggttaatccagccctcgctcgaataaatggtatttct
attgagggacatctgggaaaaaccctgtatgacattgcccctcagttagcagagtatctt
gaagggattttacgacaggtgatcgacacaggggaagccatttgcaacattgaagtgaga
gggaaaatgcctgccacctcagagattgaacgctgttggatagccagttattatcccgtt
gattttctcaatgatggtcggggggttggggcggttgtcgttgagattacgcaacgagtc
caggccgaagaagccctacgccatagtcaggctcgattacaagaagcgcaacgattggcc
aaagtgggcaattgggaactgaaacacgaggacaatcttaccctagagacagcacaacct
gactgttcaaaggaactctctgacatttaccaatttgatccccaacaatcttgctttagc
ttagaagatatcctacactgtcatccccctgcagaccgcaaggcactggagaacgctttt
caactattgatctttgatggtatccccttcagtttagatgttgaacttaacgtttctgag
caagaagtacactgtcttaacgtgatcggtcaagtgattcgggataaagatggtcagatt
ctcaagttctatggcactgtgatggatattaccgagcgtaaacgcatcgaacaagaactg
gtacgccgaaacaaagccctcgaagaagcgatcgccgtggctcaagtggctgactcggcc
aatcaagccaaaagcgagtttctggccaatatgagccatgaaattcgtacccccatcaac
tcgattatgttggtcagccaactgctagaaggaactaacctcgatacccagcagaaaaaa
ttgctgcaaaccctgaacaataatagcaatcacctgttaaatctcattaacaagatttta
tccctatcgaagctagaatcccgtactcttgagcttgagcatcgcccctttcaccttaac
cagatgttccaagagctttctcacacctttaccccgcaagcacaaagcaaagcaattggc
ctcacctttactattgcctcagaggttcccgatgtcttgatgggagatgactttcgcttg
cagcaagtattcagtaatctcattagtaacgccattaagttcacgttttcgggtcaggta
accgttaccgcaaccctccctaatgacacagtttctcagtcttctcctgtgacattatac
tttaccgtacaagatacgggcattggaattgacccgaccaaacaagacagtttgtttcag
ccttttgtccaggccgacacctccactacccgtcaatttggtggtacagggttagggttg
accatttgtcgccgtattgttcaaagcatgaagggagaaattggcttagatagcagggtg
gggaaaggttccaccttttgggtaaaaataccctttgctctgggtgatggtatccgtctt
cctgaaacggcggaaaccaacaatcccgatccagaacgacaggccactgcgccgactgct
ttgaaaattttactggtggaagattatgaagataatcgctttctgatgttgatgttgctg
gaaaatttgggttatcaggctgactgggtgaccaatggtcaagaatttctcgatcaaaca
gaggaacaggagtatgatcttgtttttttagactgtcagatgcccatattagacggttac
gaggctatacagcgttttcgccagcgagaaggggcaagcaatcatacagtggtaatcggg
atcactgctcatgcaatggaaggcgatcgccagaagtgtttagacgctggcatggatgac
tatttaagtaaacctatcatcatggaaaacttagtcaatttattagaaaaatggtcttga

DBGET integrated database retrieval system