KEGG   Cyanothece sp. ATCC 51142: cce_2357Help
Entry
cce_2357          CDS       T00686                                 

Gene name
sucC
Definition
putative succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cce_2357 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cce_2357 (sucC)
   00640 Propanoate metabolism
    cce_2357 (sucC)
   00660 C5-Branched dibasic acid metabolism
    cce_2357 (sucC)
Enzymes [BR:cyt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     cce_2357 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2409132..2410385
Genome map
AA seq 417 aa AA seqDB search
MGQTKTMDLLEYQAKELFHQVGIPVLPSQPIAQLSELKHLHIRYPVVLKSQVHSGGRGRA
GGIRFVQNTIDAVAAAQAIFSLPILGEYPEVILAEARYDTQDEFFLSILLDYQLQRPVLM
GSAKGGIDVETLLKHMHKVILDQGFSPFYARRLATKMGLRGPLIHGVSTILEKMYQLFIE
KDLDLIEINPLAVSASGEVMALDGKITVNDMALSRHLDLLSFLSPKADQTSSVSPNQNIV
TTPPQKPRWLGSKEKGGNVGIIANGLGLTLSTWDLMVNQKGQPLGAFIIEEKSSSKSLIK
QLGIAVEKMLTLPEIQIILINIVSSEPTSALVAQGMLDYCQPTMVTPDSEERLSRPTGAN
STRQRQINSSPNSNPIQWVLRLATGDIKSIETSLSDLPIYCFEDLSEAVKKTVALTQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaacaaaaacaatggatttattggaatatcaggctaaagaactttttcatcag
gtaggcattcccgttttaccctcccaacccattgctcaacttagtgaacttaaacacctc
catattcgttatccagtggtcttaaaatcccaagtccattctgggggtcgtggcagggcc
ggaggcattcgttttgtgcagaataccatcgatgcagtggctgcagcccaagctattttt
agcttacccattttaggagaatatcccgaagtgattctggctgaagctcgttatgatacc
caggacgaattttttctctccattctcctcgattatcaattacaacggccggtgttaatg
ggttcagctaaagggggaattgatgtagaaaccctattgaaacatatgcacaaagttatc
ctcgatcaagggttttctcctttttatgcccgccgtttggctaccaaaatgggtcttcgg
ggtcccctgattcatggggtgagtaccattcttgaaaaaatgtatcaattatttatcgaa
aaagacctcgatttgattgaaattaaccccttagctgtgagtgcctctggagaagttatg
gctttagatgggaaaataaccgtcaacgatatggccttatcccgtcatctagacttgttg
agctttctttctccgaaagctgatcagacctctagcgtctcccccaatcaaaacattgtc
accacacctcctcaaaaaccccgttggcttggaagtaaggaaaaagggggtaatgtgggt
atcattgccaatgggttgggactcaccttaagtacctgggatctgatggttaaccagaaa
ggacaacccttaggagcttttattattgaagaaaaaagtagcagtaaatcgttaattaaa
cagttaggaattgctgtagaaaaaatgctcactcttcctgagattcaaatcattttaatc
aatattgtcagtagtgaaccaacatcggccttagttgctcaggggatgctggattattgt
caaccgactatggtgacaccggatagcgaagaacgattatcccgaccaacaggggcaaat
tctacccgccaaagacagataaactcctctcctaattctaaccctatccaatgggttctg
agactggctacaggggatatcaagtccatcgaaacatccctttctgatttacccatttat
tgttttgaggatcttagcgaggcggttaaaaaaaccgttgcgttaactcagtag

DBGET integrated database retrieval system