KEGG   Cyanothece sp. ATCC 51142: cce_2522Help
Entry
cce_2522          CDS       T00686                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00010  Glycolysis / Gluconeogenesis
cyt00052  Galactose metabolism
cyt00500  Starch and sucrose metabolism
cyt00520  Amino sugar and nucleotide sugar metabolism
cyt00521  Streptomycin biosynthesis
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
cyt01120  Microbial metabolism in diverse environments
cyt01130  Biosynthesis of antibiotics
cyt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_2522
   00052 Galactose metabolism
    cce_2522
   00500 Starch and sucrose metabolism
    cce_2522
   00520 Amino sugar and nucleotide sugar metabolism
    cce_2522
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    cce_2522
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    cce_2522
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     cce_2522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACB51870
CyanoBase: cce_2522
CYORF: cce_2522
UniProt: B1WS84
Position
2575054..2575971
Genome map
AA seq 305 aa AA seqDB search
MEKPSVIGLDLGGTAIKLGQFLEDGTCINSLTVATPQPSTPEAVVETMIQAIAQLTPNQN
CIALGVGTPGPADKNGRIAKVAINLAGWQDVPLADCLEKGTGLPTTIANDANCAGLGEAW
LGAGKDYEHLLMLTLGTGVGGAIILNGHLFTGHLGAAGELGLITLNFDGPMCNSGNNGSL
EQYGSIQAIRRMTGKEPAELGKLAETGDPEALDFWESYGRLLGAGLASLIYVLTPQAIVI
GGGISGSTRFFFPAVLQEIERRVLPSSRENLQLLTAKLGNQAGMVGAAKLAWELVEKQKS
LNYQV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaccctcagtcattggccttgatctcggtggaaccgctattaaacttggacag
ttcttagaagatggtacttgcatcaattctctaactgttgctacccctcaaccctcaacc
cctgaagcggtggtcgaaacgatgatacaagcgatcgcccaactcaccccgaatcaaaac
tgtattgctttgggggtaggaacccctggtccggctgataaaaacggtagaattgctaaa
gtcgctattaacctggccggatggcaagatgttcctctagcggactgtttagaaaaaggg
actggacttcccacaaccattgctaatgatgctaactgtgccgggttaggagaagcttgg
ttaggtgccggaaaagactatgaacatttgctcatgttaaccttgggaacgggagtggga
ggggcaattattctcaatggccatctgtttacaggtcatttaggggcagccggagaatta
gggttaattactctcaattttgatgggcctatgtgcaatagtggtaataacggatcatta
gaacaatatggctcaattcaagccattcgtcgtatgacgggtaaagaaccagcagaatta
ggaaaattagcggaaacaggtgacccagaagccctagacttttgggaaagctatggtcgt
ttattaggtgccgggttagctagtttaatttatgtgttgaccccacaagcgatcgtcatt
ggagggggaattagtggaagtacacggtttttctttccagccgtcctacaagaaatagaa
agacgagtgttacccagttcccgtgaaaatttacagttattgaccgcaaaattgggtaat
caagcaggaatggtaggtgcagccaaattagcttgggaattagtcgagaaacaaaaaagt
ctcaactatcaagtatag

DBGET integrated database retrieval system