KEGG   Cyanothece sp. ATCC 51142: cce_2591Help
Entry
cce_2591          CDS       T00686                                 

Gene name
folK
Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00790  Folate biosynthesis
cyt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cce_2591 (folK)
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     cce_2591 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACB51939
CyanoBase: cce_2591
CYORF: cce_2591
UniProt: B1WSF3
Position
2654319..2654804
Genome map
AA seq 161 aa AA seqDB search
MMQKCAVALGSNLGDSLNILETTITLLSQHPSIELISHSPWYQTTPIGPPQPDYFNGCAI
LKTSLTPEHLLQTLLSIEQKFGRIRREKWGPRTLDLDLLLYDDLILETPSLTIPHPLMLE
RAFVLVPLADIAASWVHPISKKTIEENLNGLNCEGIKQLVN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaaatgtgctgttgctttaggtagtaatttaggagactcattaaacatttta
gagacaacaatcaccttgttatctcaacacccttctattgagttaatatctcattcccct
tggtatcaaaccactccgataggaccccctcaacctgattattttaatggttgtgctatc
ttaaaaaccagtttaacccccgaacacttattacaaactttgctgagtatagaacaaaaa
tttgggcgtattcgtcgggaaaaatggggaccgagaaccttagatttagacttattattg
tacgatgatttaatcttagaaacgccttctttaaccatacctcaccctcttatgttagag
cgagcatttgtattagttcccttggctgatatcgcagccagttgggtacatcctattagt
aaaaaaacgatcgaagaaaaccttaacgggttaaactgtgaagggattaaacaattagtt
aattaa

DBGET integrated database retrieval system