KEGG   Cyanothece sp. ATCC 51142: cce_2591Help
Entry
cce_2591          CDS       T00686                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2654319..2654804
Genome map
AA seq 161 aa AA seqDB search
MMQKCAVALGSNLGDSLNILETTITLLSQHPSIELISHSPWYQTTPIGPPQPDYFNGCAI
LKTSLTPEHLLQTLLSIEQKFGRIRREKWGPRTLDLDLLLYDDLILETPSLTIPHPLMLE
RAFVLVPLADIAASWVHPISKKTIEENLNGLNCEGIKQLVN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaaatgtgctgttgctttaggtagtaatttaggagactcattaaacatttta
gagacaacaatcaccttgttatctcaacacccttctattgagttaatatctcattcccct
tggtatcaaaccactccgataggaccccctcaacctgattattttaatggttgtgctatc
ttaaaaaccagtttaacccccgaacacttattacaaactttgctgagtatagaacaaaaa
tttgggcgtattcgtcgggaaaaatggggaccgagaaccttagatttagacttattattg
tacgatgatttaatcttagaaacgccttctttaaccatacctcaccctcttatgttagag
cgagcatttgtattagttcccttggctgatatcgcagccagttgggtacatcctattagt
aaaaaaacgatcgaagaaaaccttaacgggttaaactgtgaagggattaaacaattagtt
aattaa

DBGET integrated database retrieval system