KEGG   Cyanothece sp. ATCC 51142: cce_2713Help
Entry
cce_2713          CDS       T00686                                 

Gene name
desC2
Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    cce_2713 (desC2)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    cce_2713 (desC2)
Enzymes [BR:cyt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     cce_2713 (desC2)
Lipid biosynthesis proteins [BR:cyt01004]
 Desaturase
  First
   cce_2713 (desC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2777654..2778487
Genome map
AA seq 277 aa AA seqDB search
MTNTIKISPDKRKPLTFNWIAIAFFSAVHLVALSAPWFFSWSALGVAIFLHWLIGSIGIC
LGYHRLLTHRSFEVPKPLEYIIAIIGALALQGSPIFWVSGHRMHHAYTEDMEKDPYSAKR
GFWWSHILWLFYDRPEFFNYDQYKKYAPDLDKQPFYRWLDRYFLLLQLPLGLLLYLLGGW
SFVIYGLFVRTVLLWHSTWFINSVSHLIGYRTYNSNDNSRNLWWAAILTYGEGWHNNHHA
YPNIAKAGLKWWELDVTWWAIKILSKLNLAKKIKLPV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatacgattaaaatatcccctgacaagaggaaaccgttaacatttaactggata
gctatcgccttttttagtgcagttcatctagttgcactttcagccccgtggttcttttcg
tggtcagctttaggggtggctatttttctccattggttgatcggcagtattggcatttgt
ttagggtatcatcgcttattaactcaccgcagttttgaagttccaaaacccctagaatat
atcattgcaatcattggtgctttagcattgcaaggtagccctatattttgggtttcagga
caccgaatgcaccatgcttatactgaagatatggaaaaagatccttactctgcgaaacgg
ggtttttggtggagtcatatactctggttgttttatgatcgtccagaattttttaactat
gatcagtataaaaaatatgccccggatcttgataaacagcccttttatcgttggttagat
cgctatttcttattattacagttacctctgggacttttactttaccttctcggtggttgg
tcatttgttatttatggtttgtttgtcagaacggttttactgtggcatagtacctggttt
attaactctgtctctcatctaataggctatcgtacttataatagtaatgataattcccgt
aacttatggtgggcagctatcttaacttatggagaaggttggcataataatcatcatgct
tatcctaacatagctaaggccggattgaaatggtgggaacttgatgtaacttggtgggca
attaagattttgagtaaactgaatttagctaagaagattaaactacccgtttaa

DBGET integrated database retrieval system