KEGG   Cyanothece sp. ATCC 51142: cce_2826Help
Entry
cce_2826          CDS       T00686                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    cce_2826 (recR)
DNA repair and recombination proteins [BR:cyt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      cce_2826 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2884669..2885277
Genome map
AA seq 202 aa AA seqDB search
MEKSPIYTPPLARLIEQLQRLPGVGPKTAQRLALHILKRPDNEIQALAKALIDAKKRVGL
CKVCFHFSEQPVCDICRNPNRDSQTVCVVADSRDVIALEKTREYRGKYHVLGGVMSPMDG
IGPEQLYIQPLVRRVTQEGVKEIILAISPTVEGETTTLYIGQLLKPFTKVTRIAFGLPMG
GDLEYADEVTLARALEGRRELE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttggagaaaagccctatatatacaccccctttagcccgcttaattgaacaactacaacgg
ttaccaggggttggacccaaaacagcccaacgccttgctttacatattctcaaacgtcct
gataatgaaattcaagccctcgctaaagctttaattgatgccaaaaagcgagtcggatta
tgtaaagtttgttttcatttttctgaacaacccgtttgtgatatctgtcgtaaccctaac
cgtgactcccaaaccgtgtgtgtggtagcagattcccgtgacgttattgccttggaaaag
accagagaatatcgaggaaaatatcatgtgttagggggtgttatgtcccctatggatggg
attggccctgaacaactctatattcaaccgttagtcagacgagtgacgcaagagggggtc
aaagaaattattttagctattagccccacagtagaaggagaaaccacgacgttatatata
ggtcaactgctcaaaccttttaccaaagtgactcgtattgcctttggtttaccgatggga
ggggatttagaatatgctgacgaagtaaccctagccagagcgttagaaggaagacgagaa
ttagaataa

DBGET integrated database retrieval system