KEGG   Cyanothece sp. ATCC 51142: cce_3134Help
Entry
cce_3134          CDS       T00686                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cce_3134 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cce_3134 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cce_3134 (trpB)
Enzymes [BR:cyt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cce_3134 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3245960..3247198
Genome map
AA seq 412 aa AA seqDB search
MTTTPISPSSNQTQYPDEIGRFGQYGGKYVPETLMPALSELETAYRRYKDDPDFQAELSQ
LLKDYVGRPSPLYFAERLTEHYARPDGTGPQIYLKREDLNHTGAHKINNALGQVLLAKRM
GKQRIIAETGAGQHGVATATVCARFGLECVIYMGIHDMERQKLNVFRMKLLGATVQPVEA
GTGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVRDFHHIIGQETRQQCQEKWD
TLPDILLACVGGGSNAMGLFYEFVKDADIRIIGVEAAGESIVSGKHAATLTKGRPGVLHG
AMSYLLQDEEGQVIEAHSISAGLDYPGVGPEHSYLKDSGRAEYYSVTDAEAVAAFQRLSE
LEGIIPALETSHAIAYLETLCPQLEGSPRIIINCSGRGDKDVQTVAKYLGNE
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccacacccatttccccatcatcaaatcaaacccaataccctgatgagatcgga
cgctttggccagtatgggggaaaatatgtgcctgaaaccttaatgccggctttgagcgaa
ctggaaaccgcttatcgtcgctacaaagatgatcctgactttcaagcagaattatcacaa
ttattaaaagattatgtcggtcgtcccagtcccctctattttgctgaacggttaaccgaa
cattacgcccgtcccgatggtactggtccacaaatttatctaaaacgggaagatttaaac
cacactggcgcgcataaaattaataacgccctcggtcaagttttattagcgaaacgcatg
ggtaaacagcgtattatcgcagaaaccggagccggacagcatggggtggcaacggccacg
gtttgcgcccgttttggcttagaatgcgtcatttacatgggcattcatgatatggaacgg
caaaaacttaatgtcttccgcatgaaactgttaggggcaacagtgcaacccgtagaagca
ggaaccggaacccttaaagatgcgacttcagaagccattagagactgggtaactaacgta
gaaaccactcattatattttaggttcggtagctggtccccatccttatccaatgattgta
cgagactttcatcatattattggccaagaaacccgtcagcaatgtcaagaaaaatgggac
actttacccgatattttactggcttgtgtaggtggtggttctaatgccatgggactgttt
tatgagtttgtcaaagatgctgacattcgtattattggagtagaagcagctggggaaagt
attgtttctggaaaacacgcggcaaccctgacaaaaggtcgtccaggggtcttacacggg
gcaatgagttatttattacaagacgaagaaggacaggtgatagaagcccattctattagt
gcagggttagattatcctggggttggacctgaacatagttatcttaaagatagtggtcgt
gctgaatattatagtgttacggatgctgaagctgtggcggcctttcaacggttatctgag
ttagaagggattattccagctttagaaacgtctcatgcgatcgcctatttagaaaccctt
tgtcctcaacttgaaggcagtccccgtattattattaattgttcaggccgaggagacaaa
gatgtgcaaacagtggctaaatatttagggaatgagtag

DBGET integrated database retrieval system