KEGG   Cyanothece sp. ATCC 51142: cce_3253Help
Entry
cce_3253          CDS       T00686                                 

Gene name
pfkA2
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cyt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyt01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cyt00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cyt00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cyt00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cyt00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cyt00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3365618..3366772
Genome map
AA seq 384 aa AA seqDB search
MSKKRIGILTSGGDCPGLNAVIRAVVKAAELNNWVVYGLPYGTDGFQDIANEKCCPEDLL
LTGRCYQLPGRIRGLDVLQFFSGSVLGSISKGHPEDPEVKAAILKGYKILNIDALIVIGG
DGSLDIIYDLAKEEKWNIIVIPKTIDNDVPFTEFSVGFSTAVEIVTQALYDLTFTAASHN
RIMIVQVMGRDAGHLALRGGIAGGADIILIPELTPYLSLDVLDGCCHQLLKLQKSGRHFG
LLVIAEGVKNQKQQKEPYIADYLLRQIQEYSQILCHEKHEDFCLLKDVDMRVTVLGHLQR
SHPPVAWDRLLATAFGIKAIELIEADNYDRLVVWQKGQVSSEPLSAVINTIKERHQQKVC
TSPVEKHDCMVKTARSLGIYLGHG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaacgaattgggatcttaaccagtgggggagactgcccagggctaaatgct
gtgattcgtgcagtggtcaaagcagccgaactcaataactgggtggtgtatggacttccc
tacggaaccgatggatttcaggacattgccaatgagaaatgttgtccagaggatctgcta
ttgacggggagatgttatcaacttccagggagaattcggggattagacgttttacaattt
tttagtgggagtgtgttggggtctatcagtaaaggacatcctgaagatccagaggtcaaa
gcagcgatcctcaaaggctacaaaatcttaaatatagatgctttgattgtgatcggggga
gatgggagcttagatatcatttatgatctagccaaagaggagaagtggaacatcattgtt
attcccaaaaccattgataacgatgttccctttacagagttttccgtggggttttccacc
gccgtcgaaattgttacccaagcgttatatgatctcacttttacggcagccagtcataac
cgtattatgattgtgcaagttatgggtcgagatgccggccatttggctttgcgtggagga
atagcaggaggtgctgatattatcctgattccggaactcaccccttacttaagcttagat
gtgttagatggttgctgtcatcaattattaaagttgcaaaaatctggtcgtcattttggt
ctattggtgattgcagaaggagtgaaaaaccagaaacagcagaaagagccttatattgcc
gattatctcctgagacagattcaggaatatagtcagattctctgtcatgagaaacatgaa
gatttttgtcttttgaaagatgtggatatgcgggtgacagttttgggacatctgcaaagg
agtcatcccccagtggcttgggatcgtctgttagccacggcttttggcatcaaagcgatt
gaactcatcgaagcagacaactacgatcgcttggtggtctggcaaaaaggccaggtgagc
agtgaacccttatcggccgttattaataccattaaagagcgtcatcaacaaaaagtctgt
acctctcccgtcgaaaaacatgattgtatggtcaaaacagcacgatcactgggtatttat
ttaggtcatggttaa

DBGET integrated database retrieval system