KEGG   Cyanothece sp. ATCC 51142: cce_3495Help
Entry
cce_3495          CDS       T00686                                 

Definition
phytase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cce_3495
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    cce_3495
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    cce_3495
Enzymes [BR:cyt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     cce_3495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3611569..3617739
Genome map
AA seq 2056 aa AA seqDB search
MIRFASFNASLNRNSEGELIADLLTPNNEQGQTVAEIIQRVNPDVILINEFDFDGVGDAA
QLYSNNYLNVSQNGVNSIDYPYFYVAPSNTGIASGFDLDNNGEVVTNPGEFGYGNDAFGF
GNFPGQFGMAVYSKYPIDFSNVRTFQTFLWKDMPDALLPVDSVRGESYYSEEELNSFRLS
SKSHWDLPILIDGETVHFLVSHPTPPVFDGEEDRNGRRNHDEIRFWSDYITPGKGGYIYD
DQGNFGGLKVGEKFVIAGDQNADPFDGDSVNNAINQLLDNPYINTSVTPESEGGVDASNR
QGGVNDNHIGDPKFDTADFNDNNPGNLRVDYVLPSENLEIKETGVFWPTSDDPLFDLVGN
FPFPSSDHRLVYTDVNVKKSMIDSIRKTVQSINFIGEVNFPTGLTFEGTEFGGISGLVYD
HFNGVYYGLSDDRSQLNDARFYSLNIDLSDGILDGQDITFNGVTTLLDEDGNPFINNRID
PEGIALTSRGTLFISSEGNANTLLDPFVNEFSLSGQQFNTLPVPSKFLPIADQSSGIRNN
QAFESLTITPDERYLYTAVENALWQDGINSTLENESAVRILQYDLKTGEAAKEFLYFTAP
IPNDSNPSGGFADNGLVELLAIDNTGTFLALERSFAAGVGNNIRLYQVNLQGATDISQFD
SLAIDPDNPNDGLFDVDSVAQKRLLIDFDELGITLDNSEALAFGPTLPNGNQSLIVVSDN
NFNDSQFTQFLAFELDINSIPFVTPTLETPSEIRYDDPTDSEVVEGSDSDDPAIYIHPDD
VEQSLVITALKNGGLAVYDLDGNELQKIAPDNIRYNNVDLVYGFNLDGESIDIAVVSDRR
NDTLVIFEIDPTTQQLTDITSPNILESIFGVDDGEATAYGLATYTSPVTGEVYTFVSQAD
GDQIAQLKLISDGQGNITAEIVRTLSVPIPDGGEVEDAQVEGMVVDRELGYLYVGQEGFG
IWKFYAEPNSSEIGTIVDTVKDINPDSNLTADVEGLTIYYGEDGQGYLLASSQGDSSFAV
YDRQGSNSYLGNFVVGENNGIDGVEESDGADIINVALGDKFPKGLLVVHDGSNENATVFQ
DPEDREIQNFNTNFKYIDLEDLSATLPFFKLNTKGYDPRNPVPNSLINGIASGDTTQNST
VLWARSTFTGDVTIEYSTDANFSSIIATETLTVTDPTLPVKVEIENLTPNTQYYYRVTDA
AKDTAIGEFKTSAELGTNVGLTFGVSGDWRGELAPYPAIANASDRDLDFFVEHGDTIYAD
IESDAVKNPDGTRKQQAETIEEYRAKHSEVYDSRFGFNFWEELRANTSILATIDDHEVIN
DFAGGANADTDDRFSETEGLINDTELFENGMQTFQEYNPLRDEFYGDVGDERFNGERKLY
RYSNYGSDAAVFVLDTRSFRDDALEGPENFLDTGDRLEVLNQSLTQDRTLLGSVQLADLK
QDLLDAENNGITWKFVMVPEPMQNIFPGINTDAFEGYGKERTEILKFINENSIDNVVFVA
ADVHTTFVNNLTYQEEPEGEQIATNAFEITTGAVAFEQPTGEILGNLFTAGNASLQTFYD
SLPIAPDTDDLPNDKDDFVKQAINNVLLNSLGFDPLGLNNNLPQAEGLIDATLIQGDYFV
GHTYGWTEFDIDPETQQLKVITYGIEAYSEDELLADIDNITSRQPKIVSEFVVNSTVNGS
FPKTVNGTDNDDFIDSVDPDNGFNFNGDNQILFAGLGNDFIDVTFAPGNNIINLEEGDDI
VFSGSNNTLNGGEGKDTFFVGTGGGNNTITGGENADDFVIVTDEQDLPIEPNIITDFNPS
QGDKISLLNTSFDYSDRGSSWNTIQDNNDTVITVFDQRVAILKNTDADSLTSDNFFFSNT
NNNNNNVTPITEEENEPINTDNSNATNSDPIIENNDPNNIPQSDDQGELFDLREFVGRQV
QADFLVSRSASYNNFIGFYEIDDLTGRIDGLTPGEEGYQEAALSRQVSAIGLQVEDNETA
NITEFFTGGSIYAPFMIVKGTPETLRKSSSIYFPFLGANKDNKDRVRLLAQNVFGFEDSR
DFDYNDLIVETTLTVI
NT seq 6171 nt NT seq  +upstreamnt  +downstreamnt
atgattcgttttgctagttttaatgcttctttaaaccgtaattcagaaggtgaattaatt
gcggatttattgacccctaataatgaacaaggtcaaacggttgctgagattattcaacgg
gtcaaccctgatgttattttaattaacgaatttgattttgatggagtcggtgatgctgct
caactatacagtaataactatttaaacgttagtcaaaatggggttaattccattgactat
ccttatttttatgttgccccatctaacacaggaattgcatcaggatttgacttagataac
aatggagaagttgttacaaatcctggagaatttggctatggaaatgatgctttcggcttt
ggcaactttcctggtcaatttggtatggcagtgtattcaaaatatcccattgactttagt
aatgttcggacatttcagacttttttatggaaggatatgccggatgctttattaccggtt
gattcggttaggggggaatcttattattcagaggaagagttaaatagttttcgtttatct
tctaagagtcattgggatttaccaatattaattgatggagaaactgtccactttttagtc
agtcatcccactccgccggtatttgatggagaagaggatagaaatgggagaagaaaccac
gatgaaatccgtttttggtcagattatattactcctggaaaggggggttatatttatgat
gatcaaggaaactttggggggttaaaagtaggggaaaagtttgtcattgcaggggatcaa
aatgctgatcctttcgatggagatagtgttaacaatgccattaatcaattattagataat
ccttatattaatacctctgttaccccagaaagtgaggggggtgtagatgcttctaataga
caagggggagttaatgataatcatatcggtgatcctaagtttgacacagcagactttaat
gataataaccctggtaatttacgggtagattatgtgttaccttctgaaaatttagagatt
aaagaaactggggttttttggccaacttctgatgatccattatttgatttagtgggaaat
tttccgtttcctagttctgatcatcgtttagtttatacagatgttaatgtgaaaaagtca
atgattgattcaattcgtaaaacagttcaaagtattaactttatcggtgaggttaatttc
ccaacgggtttaacctttgaagggacagagtttggcggtatttctggtttagtttatgat
cactttaatggggtttactatggtttatctgatgatcgcagtcagttgaatgatgcccgt
ttttatagcctcaatatcgatttaagtgatggcattttagacggacaagatattacgttt
aatggggttaccacgttattagatgaagatggcaacccatttattaataatcgtattgat
ccagaagggattgcgttaacctcacgaggaactctatttatttcttcagaaggcaatgct
aatacattacttgatccatttgtcaatgagttttctttatctggacaacagtttaatacg
ttaccagtcccttctaaatttttaccaatagccgatcaaagtagtgggattcggaataat
caagcctttgaaagtttaactattactcccgatgaacgatatttatatactgctgtagaa
aatgcgttatggcaagatggaattaactcaaccctagagaatgaaagtgcggttagaatt
ttacaatatgacctaaaaacgggagaagcagctaaagaatttttatattttaccgctcct
attcctaatgattctaatccctctgggggatttgctgataatgggttagtagaattatta
gcgattgataatacaggaactttcttagcattagaacgctcatttgctgctggtgtaggt
aacaatattcgcctctatcaagttaacctacagggggcgacagatatcagtcagtttgat
agtttagccattgatcctgataatcctaatgatggcctttttgatgtggattcggtggca
caaaaacgcttattaattgattttgatgaattaggtataactttagataacagcgaagct
ttagccttcggtccaaccttaccaaatggtaatcaatctttaattgttgtcagtgataac
aattttaatgacagtcagtttactcaatttttggcctttgaactcgatattaattctatt
ccctttgtcaccccaaccttagaaaccccttcagaaattcgttatgatgatcccactgat
tcagaagtagtagaaggttcggactctgatgatccagcaatttatattcatcccgatgat
gttgaacaaagtttagtcattacagcattaaaaaatgggggattagcagtttatgattta
gacggaaacgaactacaaaaaattgcccctgataatattcgttataacaatgtggatctg
gtttatgggtttaacttagatggggaaagtatagatatcgcagttgtcagcgatcgccga
aatgatacgttagtaatctttgaaattgatcccaccacacaacagttgacggatatcaca
tctcctaacattttagaaagcatttttggggtagatgatggcgaagcaactgcttatggt
ttagcgacttataccagtcccgttactggagaagtttatacctttgtttcccaagcagat
ggagatcaaattgcccaattaaaattaatatcagacggacaaggtaacattacggctgaa
attgttcgtactttatctgttcccattcctgatgggggtgaggtagaagatgcacaagtt
gaaggaatggtcgttgatcgagaattaggatacttatatgtaggacaagaagggttcgga
atttggaaattttatgccgaacctaatagcagtgagataggaacaatagttgatacagta
aaagatattaatcctgatagtaacttaaccgcagatgtagaaggattaaccatttattat
ggagaagatggtcaaggttatttactcgcatccagtcagggagatagttcttttgctgtt
tacgatcgccaaggaagtaactcttatttaggtaactttgtggtaggagaaaataatgga
atcgatggtgtagaagaatctgacggggccgatattattaatgttgcgttaggggataag
tttcccaaaggactattagtcgttcatgatggatctaatgaaaatgcaacggtatttcaa
gatccagaagatagagaaattcagaattttaacaccaattttaaatacattgatttggaa
gatttaagcgcaactttacccttctttaaactaaatacaaaaggatatgatccccgaaac
cctgtccccaactcccttatcaatggtattgcaagcggtgacaccacccaaaacagtacg
gtgttatgggcccgaagtaccttcacaggagacgtaaccattgaatactccaccgatgct
aacttttcctctatcattgcaaccgaaaccctcactgttaccgatcctacccttcccgtt
aaagtagaaattgagaacttaacccccaatacccaatactactatcgtgtgacagatgcc
gccaaagataccgctatcggggagtttaaaacgtctgcggaactgggaactaacgtaggg
ttaacctttggagtcagtggagactggagaggagagttggccccctatcctgcgatcgcc
aatgcaagcgatcgggatctggactttttcgttgaacatggggataccatctatgcagac
atcgagtctgatgcagtgaaaaaccccgatggaacccgtaaacaacaagcagaaaccata
gaagagtatcgggccaaacatagcgaggtgtatgactcccgtttcgggttcaacttttgg
gaggagttacgggccaatacttccatccttgcaaccatcgacgatcacgaagtcatcaac
gactttgccggaggggctaatgcagacaccgatgatcgcttcagcgaaacagaagggttg
atcaacgacacggaactctttgaaaatggaatgcaaaccttccaggaatataatcccctc
agagacgaattttatggggatgtaggggacgaaagatttaacggggaacggaaactctat
cgctatagtaactatggtagtgatgctgctgtatttgtgttagatactcgttcctttcgt
gatgatgcgttagagggtcccgaaaactttttagatacaggcgatcgcttagaggtttta
aatcagtctttgacgcaagatagaaccttattaggaagtgtgcaacttgcggatcttaaa
caagacttattagacgcagaaaataatgggattacctggaaatttgttatggttcctgaa
ccgatgcaaaacatctttccgggtatcaatacggatgcgtttgaagggtatggaaaagaa
cgcacagaaatactcaaatttatcaacgaaaatagcattgacaatgtggtttttgtggct
gctgatgttcacaccacttttgttaataatctcacttatcaagaagaaccagaaggggaa
caaattgctacaaatgcgtttgaaataacgaccggtgccgttgcttttgagcaaccaact
ggagaaatattaggtaatttatttacagcaggaaatgctagtttacaaaccttttatgat
tctctaccgattgcaccagatactgatgaccttcctaatgataaagacgattttgttaaa
caagcaatcaacaatgttttattaaattcattaggatttgatccgttaggactgaataat
aatctaccccaagcagaaggattaattgatgctactttgatacaaggtgattattttgtc
ggtcatacttatggttggacagagtttgatattgacccagaaacacagcaattgaaggta
atcacctacggaattgaggcttattctgaagatgagttactcgctgatattgacaatatt
acttctcgtcagccgaaaattgttagtgaatttgttgttaattctactgtcaatggttct
tttcctaaaacggttaacggaacagataatgatgactttattgactcagttgatcctgat
aatggtttcaattttaatggcgataatcaaattctttttgctggtttaggtaatgatttt
attgacgttacttttgcaccaggaaacaacataattaacttagaagagggtgatgatatt
gtcttttcaggaagcaataatacgttaaatggaggagaagggaaagacaccttttttgtg
ggaactggtggaggaaataacaccattaccggcggtgaaaatgctgatgattttgtcatt
gtcaccgatgaacaagacttacccattgaaccgaatattattaccgattttaatccgtca
caaggagataaaatcagcttactaaacaccagttttgattatagcgatcgcggatcatct
tggaataccattcaagacaataatgacaccgttatcactgtctttgatcaacgggttgct
atcctcaaaaataccgatgcagatagcttgacttccgataatttcttcttttctaatacc
aataataataataataatgtaacccctatcactgaagaggaaaacgaaccgatcaatact
gataattcaaatgccacaaattccgatccaattatagaaaataatgaccccaataatatc
cctcaaagtgatgatcaaggagaattatttgacttaagagaatttgttggaagacaagtt
caagctgactttttagtcagtcggagtgctagttacaacaactttattggcttttatgaa
attgatgatttgacaggaagaattgatggtttaaccccaggagaagagggttatcaagaa
gctgctttatcccgtcaggtatcagcaatcggtttacaggttgaggacaatgagactgct
aatataacagaatttttcacaggaggaagtatttatgctccttttatgattgttaaaggt
acccctgaaactttgagaaaatcatcatcaatttacttcccatttttaggagcaaataaa
gacaataaagatcgtgttcgtctcctagctcaaaatgtatttgggtttgaagattctagg
gattttgactacaatgatcttatcgttgagacaactttaacagttatttag

DBGET integrated database retrieval system