KEGG   Cyanothece sp. ATCC 51142: cce_3498Help
Entry
cce_3498          CDS       T00686                                 

Definition
protein-arginine deiminase
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
cyt  Cyanothece sp. ATCC 51142
Brite
Enzymes [BR:cyt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     cce_3498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3620351..3622345)
Genome map
AA seq 664 aa AA seqDB search
MMRNFKITPLSSNSRVNRSSHEVVLVTGQLINIPIKHLIDSSVEWVELKVRGELRVKQAN
LSVLLSEKVLISPKDLADSLIVQGNTYSEELDDRSLTINLLDKQQNLIVSYGLYFTVLRI
CLDVDADRDGVVEENNPNKGNWKQGKDGYGAILLVNSDRDRPEAHEEDYHLKGLLEIKDC
SLMVVRKVGPKRLPSQYDLRVWVSEENAPYLRIFDQLETNYGHELVGHGHQQGNLIKQDI
TKDIFLAVEGLHYRDIDFDGIIFINLSLVKDNEILYTDRVRFQVAPWIMTPHTLSPQTVY
IARIASGSNYKMIEQMRFVVGASKAQLEVVSSIRYRNDRWMQDEIEFGYSESPGHFMYVV
LNSPRDRGLDEFPEEELLGIDVGHITRKNPEATTLDSFGNLEVSPPVTVDGVDYPFGRIL
FGGNHSDAPEYSTRMVKNIRDFLYAQKIQPPIELFCDWLEVGHIDEFMTFVPTKTAKGFK
LILTSPNKYYEIIQALKEQHQTELTQRTRIGDMSITDLLSNQELLQDNQRFQRYIDWNRD
ILKQKLGLREDDIIDIPGLFQGAGHQKRAETFFPNMVNMLVLDNHLAIPKPFGPKINEEC
QIEACVKNLLEPFGCTCYFIDNWEPYFLGRGEIHCGTNTRRKPFQTKWWEIASDLTEHQQ
PNNY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
ttgatgagaaacttcaagattacccctctctcttccaattctcgtgtgaatcgttcttct
catgaagttgttttagtcactggtcaacttattaatattccaattaaacatttaattgat
tcttctgttgaatgggttgaattaaaagtaagaggagaattaagggttaaacaagccaat
ttatcggtacttttatcagaaaaagtcctaatttcccccaaagacttggctgatagttta
attgtgcaaggaaatacttatagtgaagaattagatgaccgctctttaaccatcaatttg
ttagataaacaacaaaacttgattgttagttacggcttatattttactgtattaagaatc
tgtttagatgtagatgccgatcgggatggggtggtggaagaaaataacccaaataaaggg
aattggaaacaaggcaaagacggttatggagcaattcttttagttaatagcgatcgcgat
cgaccagaagctcacgaggaagattatcacctcaaaggattactagaaattaaagattgt
agtctcatggtggttcgtaaagttggcccgaaacggttaccttctcaatatgatttaagg
gtctgggttagtgaagaaaatgccccttatcttcgtatttttgatcaactggaaacgaat
tatggtcatgaattagtaggccatggacaccaacaaggcaatttaataaaacaagacatt
acgaaagatatctttttagccgtcgaaggacttcattatcgggatattgattttgatggc
atcatttttattaatttatctttggttaaagacaatgaaattttatatacagatcgggta
agatttcaagtcgctccttggattatgactccccatactttgagtcctcaaactgtttat
attgcaaggattgcatcgggttcgaattataagatgattgaacaaatgcgctttgtcgtt
ggagcctctaaagctcaattagaagtggtttcttctatccgttatcgcaacgatcgctgg
atgcaagatgaaattgaatttggctatagtgaatctcctggtcactttatgtatgttgtc
ttaaattctcctagagatcggggcttagatgagtttcccgaagaagaacttttaggaatt
gatgtcggccatataacacgcaaaaatccagaagcaactacccttgattcttttggtaat
ttagaagtaagtccccctgtgacagttgatggggttgattatccgttcgggagaatttta
ttcggaggaaatcattctgatgccccagaatattcaaccagaatggtgaaaaatattaga
gattttctttatgctcaaaaaattcaaccgcccattgagcttttttgtgattggttagaa
gtgggacatatcgatgaatttatgacttttgttccaactaagacagcaaagggatttaaa
ctaattttgaccagtcctaataaatattatgaaattattcaagctctaaaggagcaacat
caaactgaattgactcaaagaactcggatcggtgatatgtctatcactgatcttttatca
aatcaagaattgctccaagataatcaacggtttcaaaggtatattgactggaatcgagac
attttaaaacagaaattaggactaagagaagatgatattattgatattccagggttattc
caaggggcaggtcatcagaaacgggccgaaacttttttccctaatatggtgaatatgtta
gtgttagataatcatttagctattcccaaaccttttggtccgaaaatcaatgaagaatgt
caaatagaagcttgcgtaaaaaatcttttagaaccatttggttgtacttgttattttatt
gataattgggaaccctatttcttaggacggggagaaattcattgtggaaccaatactcga
cgtaaaccatttcagacaaagtggtgggaaattgcctcagatttaacagagcatcaacag
cctaataattattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system