KEGG   Cyanothece sp. ATCC 51142: cce_3607Help
Entry
cce_3607          CDS       T00686                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    cce_3607
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    cce_3607
Enzymes [BR:cyt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     cce_3607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3734624..3737032)
Genome map
AA seq 802 aa AA seqDB search
MVATPNKPQVEQTPLSPEELRKIHAYWSACNYLAVGMIYLRDNPLLKEPLSENHIKNRLL
GHWGSSPGLSFIYIHLNRLIKKYDLNTIYIAGPGHGAPGVLGPVYLEGTYSEIYPDKSQD
EEGMKAFFKQFSFPGGIGSHCTPETPGSIHEGGELGYSLSHAYGSVFDNPNLISVAVVGD
GEAETGPLATAWHSNKFLNPIRDGAVLPILHLNGYKIANPTILARVSHEELECLFKGYGY
KPYFVEGSDPEVMHQKMAATLETVISEIKAIQKEARDSGVAKRPLWPMIVLRSPKGWTGP
KEVDGKKTEDFWRSHQVPLSGMHNNPEHLKLLEEWLRSYKPQELFDDTGKLIPELKDLAP
TGNRRMSANPHANGGLLRKDLKMPDFRNYAVEVDQPGAVEAENTKRLGVFLRDVMANNMT
TFRVFGPDETASNRLTPIYEASKKVWMGEIIDADADGTEITTDGRVMEMLSEHTLQGWLE
GYLLTGRHGFFHTYEAFAHVVDSMFNQHAKWLDICKHEVPWRVPIPSLNILLSSTVWRQD
HNGFSHQDPGYVDLVTNKSPDVVRVYFPPDANCLLSVADHCLKSKNYVNVIVADKQKHLQ
YLSMEEAVQHCTKGIGIWEWASNDDCGKEPDEPDVIMASCGDVATRESLAATAILRQEFP
HIKVRFINVVDLFKLQPESEHPHGLSDRDFDTLFTTNKPIMFNFHGYPWLIHKLTYRRTN
HHNLHVRGYKEKGNINTPLELAINNQIDRFNLVLDVIERVDKLGSAAAYVQQRMKNAIIE
HKAYAYENGIDKPEISNWKWPL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggttgctacacctaataaaccacaagtcgaacaaactcccttatctcccgaagaattg
agaaaaatccatgcttattggtctgcttgtaattatttagccgtaggcatgatttattta
agagataatcccttacttaaagaacccttaagcgaaaaccacattaaaaaccgtttatta
ggtcattggggatcaagtcctggcttaagttttatctatattcatctcaatcgcctcatc
aaaaaatacgatttaaacacgatctatattgccggtcctggtcatggtgcgcctggagta
ttaggacctgtttatttagaaggaacctattcagaaatttaccctgataaaagccaagat
gaagaaggcatgaaagcctttttcaaacaattttctttccccggtggtatcggtagtcat
tgcaccccagaaacccctggatcaattcacgaaggaggagaattaggctatagtttatcc
cacgcttacggttccgttttcgataacccgaatctcattagcgttgccgtagtgggagat
ggagaagcagaaacgggtcctctggctactgcttggcattctaacaaattcctcaacccg
atccgagatggtgccgttttacccattttgcacctgaatggttacaaaatcgctaatcct
accatattagcccgtgtctctcacgaagaattagaatgtctctttaaagggtacggttat
aaaccctattttgttgaagggtctgatccagaagtcatgcatcaaaaaatggctgctacc
ctcgaaactgtgatttccgagatcaaagccattcaaaaagaagcccgtgacagtggggtg
gccaaacgccccttatggccgatgattgtgttacgctctcctaaaggatggaccggaccc
aaggaagtggatggcaaaaagaccgaagacttctggcgatcgcaccaagtccccttatcg
ggaatgcacaacaaccccgaacacctaaaactcctagaagagtggttgagaagttataaa
ccccaagaactctttgacgacaccggaaaactcatccctgagttaaaagacttagccccc
actggaaaccgtcgtatgagtgctaatccccacgccaacggtgggttattgcgaaaagac
ttaaaaatgcccgattttcgcaactatgccgtagaggtagaccagcctggcgcagtggaa
gcagaaaacaccaaacggttaggagtctttttacgggatgtcatggccaataacatgacc
acattccgtgtctttggccccgatgaaaccgcttctaaccgcttaacacctatttacgaa
gcgagtaaaaaagtctggatgggtgagatcattgacgcagacgcagacggcacagaaatc
accactgatggccgagtcatggaaatgctcagcgaacacaccctacaagggtggttagaa
ggctacttattaaccggtcgtcacggctttttccatacttacgaagcctttgcccatgtg
gttgattcgatgtttaatcaacacgcaaaatggctcgatatttgcaaacatgaagtccct
tggcgtgttcctattccttctttaaatattcttctgtcttcaacagtttggcgacaagat
cataacggattttctcaccaagatccaggctatgtggacttagtaactaataaaagtcct
gatgtggttcgggtatattttcccccggatgctaactgtttattatctgttgctgaccac
tgtttaaaaagcaaaaactacgttaatgtcatcgttgctgataaacagaaacatctgcaa
tatttgagcatggaagaagctgtccaacactgtaccaaaggcattggtatttgggaatgg
gctagtaacgatgactgtggaaaagaaccagatgaacctgatgtaattatggcttcttgt
ggggatgttgctacacgggaatccttagcagcaacggcaattttacggcaggaatttccc
cacataaaagtccgttttattaatgtggtggacttgtttaaattgcaacccgaatcagaa
catcctcacggtttatcggatcgggattttgataccttgtttactaccaataagcccatc
atgttcaattttcatggctatccctggttaattcataagttaacctatcgtcgcacgaat
caccataatcttcatgttcgtggctacaaagaaaaggggaatattaatacgcctttagag
ttagccatcaataaccaaattgatcgctttaacttagttttagatgtgattgaacgggtt
gataagttaggatcagcagcagcttatgttcagcaacggatgaaaaatgccattattgaa
cacaaagcctatgcttatgaaaatggtatcgacaaaccagaaatctctaactggaaatgg
cccttgtaa

DBGET integrated database retrieval system