KEGG   Cyanothece sp. ATCC 51142: cce_3935Help
Entry
cce_3935          CDS       T00686                                 

Gene name
folE1
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4068364..4069083
Genome map
AA seq 239 aa AA seqDB search
MTIASSNGSNFRQSNGSNVLNPNLVERVASRPDRNTHNGQQATIQPTSDESTEKMKEAVY
TMLEAVGEDPEREGLLKTPKRVAEAMKFLTQGYNQSLEELVNGAIFDEGHNEMVLVRDIN
FFSLCEHHMLPFMGQAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQIAEAIQEI
LEPRGVAVVMEASHMCMVMRGVQKPGSWTVTSAMIGEFDEEQKTREEFLNLIRHQPKFF
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagcttcctccaacggctccaactttcgtcagtctaatggctctaacgtgctt
aaccctaatttagtggaacgggtggccagtagacctgatcgcaacacccataatggacaa
caggctacaattcagcctacgtctgatgaaagcaccgagaaaatgaaagaagccgtctac
accatgttagaagcagtaggagaagatcctgaacgtgaagggttactcaaaaccccaaaa
cgggttgcagaagccatgaaatttctaactcaaggctataatcagtccctagaagagttg
gtcaacggagccatttttgatgaaggccataatgaaatggttctagtgcgagatatcaat
ttctttagcctctgtgaacatcatatgttaccttttatgggacaagctcatgtagcttat
attcctaaccagaaagtggtcgggttgagtaaattggctcgtatcgttgagatgtactcc
cgtcgtttacaagtacaagaacgtctcacccgtcagatcgctgaagccatccaagaaatt
ctagaaccccgtggtgtagcggtagtaatggaagccagtcatatgtgtatggtcatgcgt
ggggttcaaaagccgggatcttggaccgttaccagtgcgatgatcggcgaatttgatgaa
gaacaaaaaacccgtgaagagtttcttaatttaattcgtcatcaacccaaatttttttaa

DBGET integrated database retrieval system