KEGG   Cyanothece sp. ATCC 51142: cce_3989Help
Entry
cce_3989          CDS       T00686                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cyt01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cyt01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4123137..4124111)
Genome map
AA seq 324 aa AA seqDB search
MTSSITELSTTLSKPKPRRLSEMPHTIVLAAHPLKKLRAFALVFMGLPFLGSLIAIVLAS
KLGIDGIDLGILLMMLIIAQIGIEVGYHRFFSHHAFKAKKSVAIFLGIAGSMAAQGTISY
WISNHRRHHANTDHSLDPHSPYHYGDGFLNRLLGIWHSHIGWMFNSEATYMGRYGRDLLN
NEIVTYVDSHYFKWIVLGVAFPALIGGLLHGNAYGVLTGFLWGGLFRIFLGQQLVYSVNS
LCHLVGKRPFKTNDQSTNINVLSIVTCGGSLHNTHHAFPDTAINGLNWWQIDPGAWFIRS
LEFMGLVWDVKLPSQAMMEAKRYC
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttcaatcacagaattatctacaactttatcaaaaccgaaaccaagacgttta
tctgagatgcctcataccatcgtcttagcagcacaccctctcaaaaaactgcgagctttt
gctcttgtttttatgggtcttccttttttaggtagcttaattgcgatcgttttagcatcg
aaactaggtattgatgggatcgatcttggtatccttctgatgatgctaataattgctcaa
attggcattgaagttggatatcatcgctttttttcccatcatgcttttaaggctaagaaa
tccgttgccatatttctaggaatagctggtagtatggccgctcaaggtacgatttcttat
tggatcagcaatcaccgacgacaccatgccaatactgatcacagtctcgatcctcactct
ccctatcattatggagatgggtttttaaatcgtttgttgggtatttggcattctcacata
ggatggatgtttaactcagaggcaacctatatgggtcgatatggtcgggatctcctgaat
aatgaaatcgttacctatgttgactcacactacttcaaatggatagttctcggtgtcgct
tttccggccttaataggaggactacttcatgggaacgcctacggtgtattaacgggattt
ttatggggtggactcttcaggatatttttaggacaacagcttgtttacagcgttaattcc
ctatgtcatttagttggtaagcgaccctttaagaccaatgatcaaagtaccaatattaat
gtattgagcatcgtaacttgtggtggttcgctacataatactcatcatgctttcccagat
acggccattaatggtttaaactggtggcaaattgatcctggtgcttggttcatccgaagc
ttagaatttatgggtttagtttgggatgtaaaacttcctagccaagctatgatggaagct
aaacgttattgttga

DBGET integrated database retrieval system