KEGG   Cyanothece sp. ATCC 51142: cce_4003Help
Entry
cce_4003          CDS       T00686                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    cce_4003 (asnB)
Enzymes [BR:cyt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     cce_4003 (asnB)
Peptidases [BR:cyt01002]
 Cysteine Peptidases
  Family C44
   cce_4003 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4137410..4138915
Genome map
AA seq 501 aa AA seqDB search
MCGIAGIWGKTSQSNIEAMMESIVHRGPDANGIFVVPDGSGILGHQRLSIMDVEGGDQPI
YGDGKKAIIGNGEIYNYPQLFSDLESKYQFVTKSDTEAILHLYDDKNITAIPELDGMFSF
AIIDNNKFIAARDPIGIKPLYYSEKDGNFWFASELKAITQFCEDVKEFPPGTFFSSETGF
STYYNLPDISPDIDANVDDIVKEIQETVQASVVKRLMADVPLGAFLSGGLDSSIIAAIAK
KHKSELHTFSVGVEGSKDINAARLVSDYLGTIHHEYLITPKEAIAKLPEIIYALESFDQD
LVRSAIPCYFTSRLAAQYVKVILTGEGADELFAGYTYYKDITSDAILHTELRRSVSSLHN
INLQRVDRLTMAHSIEGRVPFLDLKMIELGQKIPAHLKLRGNPPVEKWILRKAFEDILPD
EIVWRKKEQFDEGSGTVDLLVDTLKDIMSEEQAQTYQKQHSHINLRSAEECYYHQIFMDV
FDNPTAILNNVARWADRPVLV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattgctgggatttggggaaaaaccagtcagagtaatattgaggccatgatg
gaaagcatcgttcatcgcggacccgatgctaatggtatttttgtagttccggatggatcg
ggaattttaggccatcaacgacttagtattatggatgtagaaggaggagatcaacccatt
tatggagatgggaaaaaagcaattattggtaatggggaaatttacaattatcctcaactt
ttttcagatttagagtcaaaatatcaatttgttaccaaaagcgataccgaagcgatttta
catttatatgacgacaaaaatataaccgctatccctgaattggatgggatgtttagtttt
gcgattattgataataataaatttattgctgctcgtgatcccattggcattaagcctcta
tattacagtgaaaaagatggtaacttttggtttgcctcagaactcaaagccattactcaa
ttttgtgaagatgtaaaagaatttccccccggtactttcttttcttcagaaacggggttt
tctacctattataatttacctgatatttccccagatattgatgccaatgtcgatgatatt
gttaaagaaatccaggaaaccgtacaagcttcggtggttaaaagattaatggctgatgtt
cctttgggtgcgtttctttcgggggggttagatagtagtattattgcagcgatcgctaaa
aaacataaatccgaattacacaccttttctgtgggagtagaaggcagtaaagatattaac
gcagcccgcttggtttcggactatttaggaaccattcaccatgaatatttaattactccc
aaagaggcgatcgctaaattgcctgagattatttatgccctagaatcctttgatcaagac
ttagttagaagtgccattccctgttattttacctcccgtttagcggcccaatatgtgaaa
gtgattctcacaggagaaggggctgacgaactatttgctggttatacttattacaaagat
attaccagtgatgctattttacacacggaattaaggcgatcagtttctagcttacataat
attaatttacagcgagttgatcgcttaacaatggctcattccattgaaggaagagtacca
tttttagacctcaaaatgattgaattagggcaaaaaattccggcacatcttaaactgaga
ggcaacccacccgtagaaaaatggattttaagaaaagcctttgaagatatcttacccgat
gaaattgtttggcgcaaaaaagaacaatttgacgaaggcagtggcacagtggatctatta
gtggataccttaaaagatattatgagcgaagaacaggctcaaacctatcaaaaacaacat
tctcacattaatctgcgatcagcagaagagtgttactatcatcaaatttttatggatgtg
tttgataatcccactgccattttaaataatgttgctcgttgggccgatcgacctgtttta
gtttaa

DBGET integrated database retrieval system