KEGG   Cyanothece sp. ATCC 51142: cce_4304Help
Entry
cce_4304          CDS       T00686                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cce_4304 (tpiA)
   01230 Biosynthesis of amino acids
    cce_4304 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_4304 (tpiA)
   00051 Fructose and mannose metabolism
    cce_4304 (tpiA)
   00562 Inositol phosphate metabolism
    cce_4304 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    cce_4304 (tpiA)
Enzymes [BR:cyt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     cce_4304 (tpiA)
Exosome [BR:cyt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   cce_4304 (tpiA)
  Exosomal proteins of bladder cancer cells
   cce_4304 (tpiA)
  Exosomal proteins of melanoma cells
   cce_4304 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4432449..4433186
Genome map
AA seq 245 aa AA seqDB search
MKMAVGKIIIAGNWKMHKTQGEALEFLTVLKSKVEETDEAREIVLCVPFTTLSILSKSLH
GGKVRLGAQNIHWEDKGAYTGEISGPMLTELSVDYVVIGHSERRQYFGETDKTANLRVIA
AQRHGLTPILCVGETKEQRDAGEAESVIINQLQKGLVDVDQSNLVIAYEPIWAIGTGDTC
DATEANRIIRVIRDQLSNKNVTIQYGGSVKPNNIDEIMAQSDIDGALVGGASLDPVSFAR
IVNYQ
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatggctgtaggaaaaattatcattgcaggtaactggaaaatgcacaaaactcag
ggtgaagccctagagtttttgacggtattaaaatcaaaagtagaagagacagatgaagcc
agagaaattgttctctgtgtcccctttaccaccttaagcatcctctcaaaaagtttgcac
ggaggaaaagttcgtttaggggcccaaaatattcactgggaagataagggagcttatacc
ggtgaaatttcaggcccgatgttaaccgagttgagtgttgattatgtggtcatcggccat
agcgaacgtcgtcaatattttggagaaacagacaaaactgccaatttacgagtgattgca
gcccaacgtcacggtttaacccctatcctctgcgtaggagaaaccaaagaacaacgggac
gcaggagaagcagaaagcgttattattaatcaattacaaaaagggttagtagatgtggat
caaagcaacttagtcattgcttacgaacctatctgggccattggtaccggagatacctgt
gacgcaacagaagctaaccgtattattcgtgtcattcgtgatcaattatccaataaaaat
gtcaccattcaatatggtggttctgtgaaaccgaataatattgacgaaattatggcccag
tctgatattgatggggctttagttggaggggctagtttagaccctgtgagttttgcccgt
attgttaattatcaataa

DBGET integrated database retrieval system