KEGG   Cyanothece sp. ATCC 51142: cce_4358Help
Entry
cce_4358          CDS       T00686                                 

Gene name
chlH1
Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cce_4358 (chlH1)
Enzymes [BR:cyt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     cce_4358 (chlH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4500366..4504412
Genome map
AA seq 1348 aa AA seqDB search
MDVAVFPTYLDHHKNKGALSYMFTHVKSTIRHIVPEATNGRSLLKVVYVVLEPQYQSSLS
AAVKAINKNNPKLAIEISGYLIEELRNPENYEEFKRDVAEANLFIASLIFIEDLADKVVE
AVQLHRDNLDAVVVFPSMPQVMRLNKLGSFSMAQLGQSKSAIAQFMRKRKENSGASFQDA
MLKLLRTLPQVLKYLPVEKAQDARNFMLSFQYWLGGSSENLENFLVMLAHKYSYPELFGD
KQVDYKEPIVYPDMGIWHPLSMKMFEDVPSYMEWYNSRRDISDDLKDPLAPCIGLILQRT
HLVTGDDAHYVAMVQELECMGAKVIPVFAGGLDFSKPVEAYFWKGDKERVAIVDTVVSLT
GFALVGGPARQDHPKAIDSLKRLNRPYMCALPLVFQTTQEWEESDLGLHPIQVALQIAIP
ELDGAIEPIILSGRDGSTGRAIALQDRIEAVAQRAMKWATLRKKPKLDKKVAITVFSFPP
DKGNVGTAAYLDVFGSIYEVLKALQGNGYDVQDIPESPKELMEAVIHDAQAQYASPELNI
AHRMSVEQYERLTPYSVKLEENWGPPPGHLNSDGQNLLIYGKHFGNVFIGVQPTFGYEGD
PMRLLFSRSASPHHGFAAYYTYLNQVWKADAVLHFGTHGSLEFMPGKQMGMSGDCYPDSL
IGNIPNLYYYAANNPSEATIAKRRSYAETISYLTPPAENAGLYKGLQELSELIGSYQTLK
DGGRGVPIVNTIMDKCRLVNLDQDIDIPDVDAKDMTQEERDNIVGLVYRKLMEIESRLLP
CGLHVVGKPPTAEEAIATLVNIASLDREEEGITSLPRIIADSLDRDIEEVYQNSDRGILE
DVELLQQITLATREAVASLVKEQIDAEGRVSLVSKLNFFNMGKKAPWVATLHDLGYTKVD
QEKLKPLFEYLEFCLEQVCADNELGGLLKALEGEYVLPGPGGDPIRNPNVLPTGKNIHAL
DPQSIPTLAAVKSAKIVVDRLIARQKIDNGGNYPETIACVLWGTDNIKTYGESLAQIMWM
VGVKPVPDALGRVNKLELISLEELGRPRIDVVVNCSGVFRDLFINQMNLLDQAVKMAAEA
NEPIEMNYVRKHALQQADEMGINLREAATRIFSNASGSYSSNVNLAVENSSWEEEKELQD
MYLNRKSFAFDSDNPGMMKDNRKVFESALKTADATFQNLDSSEISLTDVSHYFDSDPTKV
VANLRGDGKKPSAYIADTTTANAQVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVREL
SKRLVNTMGWSATADAVDNWVYEDVNTTFIEDEEMCKRLMNLNPNSFRKMVGTLLEVNGR
GYWETSAENLERLQELYQEVEDRIEGVE
NT seq 4047 nt NT seq  +upstreamnt  +downstreamnt
ttggatgttgcagtgttcccaacttatttagaccatcataaaaacaaaggagccttatca
tatatgtttacccatgtcaagtccaccattcgccatatcgttccagaggcaaccaatggt
cgttctttgctaaaggtggtctatgtggtgttagaacctcagtatcaaagttccctttcg
gcggccgttaaagccattaacaagaataatcctaagttagccattgaaatcagtggttat
ttaatagaagaacttagaaacccagaaaattacgaagaatttaaacgagatgtagcagaa
gccaacttatttattgcttctttaattttcattgaagacttagcggataaagtggtcgaa
gcggttcaacttcaccgtgataatctagatgcggtggtggtattcccttccatgccccaa
gtcatgcgcttaaataagttgggtagcttttccatggcccagttgggacagtccaaaagt
gcgatcgctcaatttatgcgcaaacgcaaagaaaattctggggcgagtttccaggatgcg
atgctaaagttattgcggacactgcctcaagtgttgaagtatcttcccgttgaaaaagcg
caagatgctcgcaattttatgttaagtttccaatactggttagggggttcttctgagaac
ttagagaacttcttagtcatgttagcccataagtattcctatcctgagttatttggggat
aaacaggttgactacaaagaaccgatcgtttaccctgacatgggtatctggcatccttta
tcgatgaaaatgtttgaggatgtgccttcttatatggagtggtacaacagtcgtcgagat
atttccgatgacttaaaagatcctttggccccttgtatcggactcattttacaacgaact
caccttgtcactggagatgatgctcattacgtcgctatggtgcaagaattagaatgtatg
ggtgcaaaagttatccctgtgtttgcgggggggttagacttttctaaacccgtagaagct
tatttctggaaaggggataaagaaagagttgctattgtggatactgtcgtatcattgaca
gggtttgccttagtgggaggtccagcgcgtcaggatcatcctaaagcgatagactcatta
aaacgcctcaaccgtccctatatgtgtgcgttacctttggtctttcaaaccacccaagaa
tgggaagaaagcgatctcgggttacatcctattcaggttgctctacaaatagccatccct
gaattagacggggccatcgaacctattatactctcaggacgagacggaagcacaggacgg
gcgatcgcacttcaagatcgcatcgaagccgtggcccagcgtgccatgaaatgggctact
ttaagaaagaaaccgaaactcgataaaaaagtggctattaccgtgtttagtttccctccc
gataaaggaaatgtgggaaccgccgcctatttagacgtatttgggtctatttatgaagtt
cttaaagccttacaaggaaatggctacgatgtccaggatattcctgagtctcctaaagaa
ctcatggaagcggttatacacgacgcacaagcacaatatgcctctcctgagttaaatata
gcccatcggatgtctgtggagcaatatgagcgattaaccccctattctgtgaagttagaa
gaaaactggggaccccctcctggacatttaaacagcgatggacaaaatttactgatctat
gggaaacactttggtaacgtctttattggggtacaacctacctttggatatgaaggtgat
cccatgcggttactattctcaagatctgcgagtcctcatcatggttttgctgcttattac
acctatttaaaccaagtttggaaagcagacgcagtcttgcatttcggaactcatggatca
ctggaatttatgccaggaaaacagatgggtatgtccggtgattgttatcccgatagtctc
attggtaatattcccaacctatactattatgcggctaataatcccagtgaggcgaccatt
gccaaacgacgcagctatgcagaaaccatctcttatttaaccccccctgctgagaatgca
gggttatacaaaggactgcaagaattaagtgagttaattggttcttatcaaaccttaaaa
gatgggggtcggggtgttcctattgttaacaccatcatggataaatgtcgcttagtcaat
ttagatcaggatatcgatattcctgatgtagacgctaaagacatgacccaagaagaacgg
gataatattgttggtttagtctatcgaaaattgatggagattgaatcccgtttgcttcct
tgtggactccatgttgtgggtaaacctcccaccgcagaagaagcgatcgcaactttggta
aacattgcttctttagaccgagaagaagaaggaattacatctttacctcgcattattgct
gatagtttagaccgagatattgaagaggtgtatcaaaacagcgatcggggtattttagaa
gatgtagaattgctacaacaaattacattagcaacccgtgaagcggtcgcatctttagtc
aaagaacagatagatgcagaaggaagggtatcccttgtatccaagctcaacttttttaac
atgggtaaaaaggctccttgggtagcaactttacacgatttaggttacaccaaagtcgat
caagaaaagttaaaacccctgtttgagtacctagaattttgcttagaacaggtttgcgcc
gataatgaattaggtgggttactaaaagcattagaaggagaatatgtcttacctgggcct
ggtggtgatcctatccgtaaccccaacgttttacctacgggtaaaaacatccatgcgtta
gatcctcagtctattcctaccctcgctgcggtcaagtctgcaaaaatagttgtagatcgt
ttaattgcgcgtcaaaaaatcgataatggtggcaattatcccgaaaccattgcttgtgta
ttatggggtacagataacatcaaaacttatggtgagtccctcgcacaaattatgtggatg
gtaggagtaaaacccgtacccgacgcattaggaagggtcaataaattagagttaatttcc
ctcgaagaattaggaagacctcgtattgatgttgtggtcaactgttctggtgtattccgt
gacctctttattaaccaaatgaacttattagatcaagcggttaaaatggcagcagaagca
aacgaacccatcgaaatgaactatgttcgtaaacacgctttacagcaagctgatgaaatg
ggaataaacctgcgtgaagctgctacccgtatcttttccaacgcttccggttcttattct
tctaacgttaacttagcggtagaaaatagcagttgggaagaagaaaaagagttacaagat
atgtatctcaaccgtaaaagtttcgcctttgattcagataaccctggtatgatgaaagat
aaccgcaaagtgtttgaatcagcgttaaaaacggcagatgcaaccttccaaaacttagat
tcatccgaaattagtttaacggatgtgtcccattattttgactctgatcccacaaaagtg
gtggcaaacttacgaggagacggtaaaaaaccctctgcttatattgcagatacgactacc
gctaatgcacaggttcgtaccctctctgaaaccgtccgtttagacgcacgtaccaagtta
ttaaaccctaaatggtacgaaggaatgttatcccacggttatgaaggtgtcagggaactt
tctaagcggttagtgaatacaatgggatggagtgcaaccgcagatgctgttgataactgg
gtgtatgaagacgttaatacaaccttcattgaagatgaagaaatgtgtaaacgtctgatg
aatttaaaccctaattctttccgtaaaatggtcggtacattactcgaagttaacggacga
ggttattgggaaacctccgcagaaaacttagaaagactgcaagagttgtatcaagaagtt
gaggacagaattgaaggtgtagaataa

DBGET integrated database retrieval system