KEGG   Cyanothece sp. ATCC 51142: cce_4423Help
Entry
cce_4423          CDS       T00686                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cyt00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4563520..4564488)
Genome map
AA seq 322 aa AA seqDB search
MSYQPEKQLALKIVKQAAKLCQRVQQTQGRKAVQKADTSPVTVADFGAQAILCQGLMEAF
PNDPVIGEEDATLLQQPELEGVRRQIIEQVQHSIPAATPEKVIDWINWGNGKVAQRYWTL
DPIDGTKGFIRGDQYAVALALVEEGEVKLGVLACPAFPREDNGKGVIFLAIRGQGAVEMP
LDGETAQQIKVDPSSNFEQLYRIESVESVHSDRQVQTAIDQRLGLTSIAKQMDSLAKYGA
IARGDAHVYTRVPLPQFEGKKENIWDHAAGVIIVEEAGGRVTDLDGKPLDFSVGAKLSNN
RGVLATNSVIHSQVLAAIQQEQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcaaccagaaaaacaattagccttgaagatagtcaaacaagcagctaaactc
tgtcaacgagttcaacaaactcaaggccgaaaagcggttcaaaaagcagataccagtccc
gtaacagtggcagattttggggcgcaagctattttatgtcaagggttaatggaggcgttt
cctaatgatcctgtcatcggggaagaagatgccaccttactgcaacaaccagagttagaa
ggggttcgccgtcaaattattgaacaggtacagcacagtattcccgccgctaccccagaa
aaggtgattgattggattaactggggtaatggaaaagtcgcacaacgttattggacgcta
gatcccatcgatggcacaaaggggtttattcggggggatcaatatgctgtagccttggct
ttagtggaagaaggagaagtgaaattaggggtattagcttgtcctgcctttcctagagaa
gataatggtaaaggggtgattttcttggctattcggggtcaaggggcagtagaaatgccc
ttagacggggaaacggctcaacagatcaaggttgatccttcgtctaattttgaacaatta
tatcggatcgaaagtgtggaatccgttcatagcgatcgccaagtccaaaccgctatcgat
caacgtttagggttaacttctatcgcaaaacagatggactctttagctaaatatggagcg
atcgccagaggagatgctcatgtatatacgagagtccctttacctcaatttgaaggcaag
aaagaaaacatctgggatcatgccgccggagtgattatcgtagaagaagctggaggcagg
gtaacagatttagatgggaagcccttagatttttctgtgggggcaaaattaagcaataat
cgtggtgttctagccactaattccgtaattcattcccaggttttagcagccattcagcaa
gaacaataa

DBGET integrated database retrieval system