KEGG   Cyanothece sp. ATCC 51142: cce_4520Help
Entry
cce_4520          CDS       T00686                                 

Gene name
hisD2
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cce_4520 (hisD2)
  Amino acid metabolism
   00340 Histidine metabolism
    cce_4520 (hisD2)
Enzymes [BR:cyt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     cce_4520 (hisD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4662685..4663980)
Genome map
AA seq 431 aa AA seqDB search
MLRIITQSAEINTELQRIRDRPYRDEIQAKEVAVGEILERIKHQGDQGLFEPFDILTTPT
NLKVSGSDLDAAYQKIPKELLDAIQTVSQKLESFYKQQLPKPWVKFEDDDVVVGKRYTPV
KRAGIYVAWDQGSPISRVLMQTLPAKMAKVPEIILVTPPDETGKVPPDILVAAQVSGVNQ
IYRIGGAKAIAALAHGTETIPKVEVITGTGGLDVILAKRMVYGTVTTDTPVDASELFIIA
DRTANPAYVAADLLAQVEQDPSSAVIVLTTDFSLAQKIQTKVQEKLQDNAHGILSEKAIA
HYSLIIIVESLEQAVNITNEFAPHYGMLALTEPWDIIEKIRAVGSLFIGHNTPKAVGDYL
GTGSVILPPSGLIRYASSVRVETFLKPSHLIEYAPTALKKLANALEILALAEGLPGTADA
INLRLVEGEDY
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcatcacccagtcagctgagataaacacagaattgcaacgaatccgcgat
cgcccttatcgagacgagattcaagcaaaagaagttgctgtgggagaaattctcgaaaga
attaaacaccaaggcgatcaaggactctttgaaccctttgacatccttaccactcccacc
aacctcaaggtgagtggttccgacttagatgcagcctatcaaaagattcctaaagaatta
ctcgatgctatccaaaccgttagtcaaaaattagaaagcttttataaacaacaactccct
aaaccttgggtgaaatttgaagacgatgacgtagtggtcggcaaacgctatactccagtc
aaacgggcaggtatttatgtcgcttgggatcaagggtcccccattagtcgggtactgatg
caaaccctacccgcaaaaatggccaaagtcccggaaattatccttgtgactccccctgat
gaaaccggcaaagttccccctgatattttagtcgctgctcaagtgagtggggttaatcaa
atttaccgtattggaggggcaaaagccatcgctgctttagcgcatggaacagaaaccatc
cctaaagtagaagtgatcacaggaactgggggattagacgttattttagctaaacgcatg
gtctatggtaccgtcaccaccgatacccccgtcgatgcctcagaattgttcattattgct
gaccgaaccgccaaccctgcctatgtcgctgccgacttattggcacaagtcgaacaagac
cctagtagtgcggtgattgtcctgacaacagatttcagtttagctcaaaaaattcaaacc
aaggtacaagaaaaattacaagataacgcccacgggattttatccgaaaaagcgatcgcc
cactatagcttaattatcatagtcgagtccctcgaacaagctgttaacatcaccaacgaa
tttgcccctcattatgggatgttagctttaaccgaaccttgggatattatagagaaaatt
cgtgccgtcggtagccttttcattggacataacacccccaaagcagttggggattatcta
ggaactgggagtgtaattttgcccccttcgggcttaattcgttacgcttcttctgtccga
gtcgaaaccttcttaaaaccttcccatctcatcgaatatgctcccactgcgctgaaaaaa
ttagccaatgccttggaaattttagccttagcagaggggttgccaggaacggctgatgct
attaatttacggttagtcgaaggggaagattattaa

DBGET integrated database retrieval system