KEGG   Cyanothece sp. ATCC 51142: cce_4591Help
Entry
cce_4591          CDS       T00686                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cyt00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4738811..4739380
Genome map
AA seq 189 aa AA seqDB search
MASGKLIVLTGPSGVGKGTLVRALLNHHPELYLSISATTRSPRQGEVEGKDYYFLSKSAF
ETMIEENQLLEWAEYAGNYYGTPRTKVEEKINQGLIVLLEIEVIGAKAIKNSFPDALRIF
ILPPSIEELEHRLRSRKTDSESAILRRLDRAKEELAVSEEFDKCIINDDLEIALAQLEKA
IFFDSSITN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaggaaagctcattgtattaaccggtcctagcggtgtgggaaaaggcacctta
gtccgtgctttattaaaccatcatcccgaactctatttatctatttctgccaccactcgt
tctcctcgtcagggggaagtagagggtaaagattactattttttaagtaagagtgccttt
gaaaccatgattgaggagaatcagttattagaatgggcagaatatgccggtaattattat
gggactccccgtactaaggttgaagaaaaaattaaccaaggtttaattgtgcttctagaa
atagaagtgattggggcaaaagccataaaaaacagctttcctgatgctttgagaattttt
atccttcccccttcaattgaagaattagaacatcgtttaagaagtcgaaaaacggactca
gaatcagcaattttacgtcgtttagatagggcaaaagaagaattggcagtcagtgaagaa
ttcgataagtgtattattaatgatgatttagaaatagctttagcgcaactagaaaaggct
attttttttgattcatcaataacgaactaa

DBGET integrated database retrieval system