KEGG   Cyanothece sp. ATCC 51142: cce_4595Help
Entry
cce_4595          CDS       T00686                                 

Gene name
glgB2
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cyt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4741916..4743871
Genome map
AA seq 651 aa AA seqDB search
MNDNATAKNRLLGEFDYYLFGQGDHHRIYEKMGAHLVEIDGVSGVYFATWAPNAYEVAVV
GDFNNWNPEANKMERTEVGIWELFIPGMKVGDLYKYSVKNHHHHCVYKTDPYGYQQEVRP
ATASIVADLSTYTWNDQGWMDKRERTNPEKQPMSVYEVHLGSWLHDSIDNPPKEGPSLPV
EQKPGARYLNYRELAEKLIPYVKDMGYTHIELLPVTEYPFDGSWGYQVVGFYAPTSRYGP
PQDFMYFVDKCHEAGIGVILDWVPGHFPKDQHGLAYFDGGPLYEYADPRKGEIKTWGTLV
FDYGRNEVRNFLIASAMFWFDKYHIDGIRVDAVAYMIELDKGREGNWVPNKYGDNGHLEA
ISFLQHLNNTIAHNYPGVVTIAEDSTAWGNVSKPASEGGLGFTFKWNMGWMNDTLKYLKE
HPNHRSNCHNKLTFSIWYAFDEKFMLALSHDEVVHLKGHLVNKMPGDEWQKMANVRTLLT
YMFAHPGKKTLFMGMEFGQTSEWQEFLDIDWYLLQYEPHKGLKRLVQDLNKMYVREPALY
MEDFSREGFEWIEANDAPRGLISFIRRDPASGDTIVAVCNFKPYVYEYYWVGLHQPGEYV
ELINSDAQVYWGSGVSNPSVIQARQWNNAPWPYALEITVPPLGAVLYKLKR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaacgcaactgctaagaaccgccttctgggagaatttgactattatttattt
ggccaaggggatcatcatcgcatctatgagaagatgggggcccatttggttgagatcgat
ggggtgtcaggggtttactttgccacctgggccccgaatgcttatgaagtcgctgtagtg
ggagatttcaataactggaaccctgaagcgaacaagatggagagaaccgaagtaggaatc
tgggaattatttattcctgggatgaaagtcggggatctctataaatattcagttaaaaat
caccatcaccactgtgtctataaaaccgatccctacggttatcaacaggaagtccgtcct
gcgacggcctctattgtagccgatctttctacctatacctggaacgaccagggatggatg
gacaaacgggaacgcactaaccccgaaaagcaaccgatgtctgtctatgaagtccactta
ggatcttggttacacgacagtattgacaaccctcccaaagaagggccaagtcttccagtt
gaacaaaaaccaggggcccgctaccttaactatcgagaactggcagaaaaattaattcct
tatgttaaagatatgggttacactcatatcgagttactccctgtcacagaatatcccttt
gacggatcttggggctatcaagtggttggtttttatgcccccacttctcgctacggtcct
ccgcaagattttatgtactttgtggataaatgtcacgaagcaggtatcggcgtaattttg
gactgggttcctggccactttcctaaagatcaacatgggttagcttattttgatggtggc
cctttgtatgaatacgccgacccccgcaaaggagaaattaaaacctggggaaccttagtg
tttgactatggacgcaatgaagtcagaaacttcctcattgccagcgccatgttttggttc
gataagtatcatattgatggcattcgggtcgatgctgtcgcctatatgatcgaattagat
aaaggtcgagaaggtaactgggttcccaataagtatggagataacggccatttagaagcc
atcagtttcttacaacatttgaataatacgatcgcccataattatcctggagttgttacc
attgctgaagactctaccgcttggggtaatgtgtctaaaccggctagtgagggaggactg
ggttttacttttaagtggaatatggggtggatgaatgataccctgaaatatttaaaagag
catcctaaccatcgttctaattgtcataataagcttacctttagtatttggtacgctttc
gatgaaaaattcatgttagccctttctcatgatgaagtggttcacctcaaaggccattta
gtgaataaaatgcctggagatgaatggcaaaaaatggccaatgttcgtaccttattaact
tatatgttcgctcatcctggcaagaaaactctatttatggggatggagtttggtcagact
tctgaatggcaagaatttctcgatattgactggtatctcctacagtacgaaccccacaaa
ggcttaaaacgcttggttcaggatctcaataaaatgtatgtccgtgaaccggctttatat
atggaagattttagccgtgaagggtttgagtggatcgaggctaatgatgcaccaaggggc
ttaatttcgtttattcgtcgtgatcctgcctctggggataccattgtcgctgtgtgcaac
tttaagccctatgtctatgaatattactgggttggtctacatcaaccaggagaatatgtg
gaattaattaactccgatgcccaagtttactggggtagtggtgtttctaatcctagcgtt
attcaagcccgtcaatggaataatgcaccttggccctatgctttagaaattacagttcct
cctttgggtgctgtactgtataaattaaagcgatag

DBGET integrated database retrieval system