KEGG   Cyanothece sp. ATCC 51142: cce_4852Help
Entry
cce_4852          CDS       T00686                                 

Gene name
hemB1
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cce_4852 (hemB1)
Enzymes [BR:cyt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     cce_4852 (hemB1)
Exosome [BR:cyt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cce_4852 (hemB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
linear:complement(90571..91575)
Genome map
AA seq 334 aa AA seqDB search
MSSTTEHLSLLHRPRRLRRTASLRRMVRETQLTVNDLIYPVFVMEGENQQEEIPSMPEIY
RYSLDLLLKEIADAANLGINAVALFPLIPTEKKDNAGTESHNPDGLVQRTIKAIKQEIPE
MAVITDVALDPFSTYGHDGIVKDGKILNDETVEVLVKQAISQAEAGADIVAPSDMMDGRV
GAIRQGLDDAGYFDVGILAYSAKYASAYYGPFRDALESAPQFGDKQTYQMNPANSREAIK
EVALDIAEGADIVMVKPALAYLDIIGRIKEYTNLPVAAYNVSGEYAMVKAAAEQGWIDEK
QVILETLTSMKRAGADLILTYFAKQVALMLPKAP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagttctactactgaacatctctccttactccatcgtcctcgtcgccttcgtcgcact
gcatccttgcgtcgtatggtacgggaaacccaactaacagttaacgatctgatttatccg
gtgtttgtcatggaaggagaaaaccagcaagaagagattccttccatgccggaaatctat
cgttattccctcgatttactgctcaaagaaatagccgatgctgctaatttagggatcaat
gcagttgcactttttcctctcattcctacagaaaagaaagataatgcaggaacagaaagt
cataaccccgatgggttagtacagcgcactatcaaagccattaaacaagaaattcctgaa
atggctgtcattactgatgtagcccttgatcccttttctacctacggtcatgatggcata
gttaaagatggcaaaattctcaacgacgaaacagtagaagtattagtaaaacaagccatt
tctcaagcagaagcaggagcagacatagtcgccccttccgatatgatggatggtagagta
ggagccattcgtcaaggtttagatgatgctggttattttgatgtaggcatccttgcttat
tcggcaaaatacgcttcagcttattatggacctttccgcgatgctttagaatctgcccct
caatttggtgacaaacaaacctatcaaatgaaccctgctaatagccgagaagccattaaa
gaagtggctttagatattgctgaaggggcagacatcgtaatggttaaaccagctttagct
tatttagatattattggtcgcatcaaagaatataccaacttacctgttgctgcttataac
gttagtggtgaatatgcaatggttaaagctgcggccgagcaaggttggattgatgaaaag
caagtcattttggaaacccttaccagtatgaaacgggcaggggcagacttaattttgact
tattttgccaaacaagtcgctttgatgttgcctaaagcaccttga

DBGET integrated database retrieval system