KEGG   Cyanothece sp. ATCC 51142: cce_4888Help
Entry
cce_4888          CDS       T00686                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00010  Glycolysis / Gluconeogenesis
cyt00071  Fatty acid degradation
cyt00350  Tyrosine metabolism
cyt00625  Chloroalkane and chloroalkene degradation
cyt00626  Naphthalene degradation
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
cyt01120  Microbial metabolism in diverse environments
cyt01130  Biosynthesis of antibiotics
cyt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_4888
  Lipid metabolism
   00071 Fatty acid degradation
    cce_4888
  Amino acid metabolism
   00350 Tyrosine metabolism
    cce_4888
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    cce_4888
   00626 Naphthalene degradation
    cce_4888
Enzymes [BR:cyt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     cce_4888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACB54234
CyanoBase: cce_4888
CYORF: cce_4888
UniProt: B1X273
Position
linear:complement(123997..125004)
Genome map
AA seq 335 aa AA seqDB search
MAMEVKQMMRAMVLEAAKEKLRLELRPIPQPDDKQLLLKIQACGVCRTDLHIVDGELTQA
KFPLILGHEIVGTVEAVGKGVKRFSLGERVGVPWLGGTCQHCRYCRTQQENLCEQARFTG
YHLDGGYAEYTVANEQFCFAIPKRYSDLEVAPLLCAGLIGYRSYRLVGDGEKIGFYGFGA
ASHILLQVARHQGRQVYAFTRPGDDLGQDFARSLGAVWAGGSEQSPPDSLDGAIIFAPVG
ALVPVALKAVVPGGVVVCAGIHMSDIPSFPYQILWQERVLRSVANLTRQDGEDFFALARQ
IPIQTQVSSFPLTQANVALDCLRQGKIKGAAVLVP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatggaggtcaaacagatgatgcgagcgatggttttggaagcagctaaagagaaa
ctacgtcttgaattacgtcctattcctcaaccagacgacaaacaactgttgctcaaaata
caagcttgtggggtctgtcgtacggatttacatattgtcgatggagaattaactcaggct
aaatttcccttaattttaggacatgaaattgtgggaaccgtcgaagccgtgggaaaaggg
gtgaagagattttctctgggggaacgagtaggagtcccttggttgggaggcacttgtcaa
cattgtcgttactgtcggactcagcaggaaaatctttgtgagcaagccagatttactggg
tatcacttagatggaggctacgcagaatacactgtggccaatgaacagttttgttttgcg
attcccaaacgttattctgacttagaagtcgctcccctactgtgtgctggattaattggt
tatcgttcctatcgtttagtcggagatggcgaaaaaatcggcttttacgggttcggtgcg
gcatctcatattctccttcaagtggcccgtcatcaaggacgacaagtgtatgcttttact
cgtcctggggatgatcttgggcaagactttgcccgctcccttggagcagtgtgggctggg
gggtcagagcaatcccctccagacagtcttgatggagcgattatttttgcccctgttgga
gcattagttcctgtggctttaaaagctgttgtccctgggggtgtggtcgtttgtgctggc
atccacatgagtgatattccttcgtttccttaccaaattttgtggcaagaacgggttcta
cgctctgttgctaatttgactcgccaagatggagaagattttttcgctttagccagacaa
attcccatccaaacccaggtgtcttcttttcctctcacacaagcaaatgttgccttagac
tgcttacgacaaggaaagataaaaggagcagcggtcttagtcccatga

DBGET integrated database retrieval system