KEGG   Cyanobacterium UCYN-A: UCYN_00100Help
Entry
UCYN_00100        CDS       T01159                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UCYN_00100
Enzymes [BR:cyu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     UCYN_00100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5513..6583
Genome map
AA seq 356 aa AA seqDB search
MTLSSPLNNHRTVFPFTAIIGQDEMKLALMLNIIDPKIGGVMIMGDRGTGKSTTIRALAD
LLPEIEVVENDPFNSHPTDLDLMGDNARKTLEENGSLITIPQKVTMVDLPLGATEDRVCG
TIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGI
SIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPSLRVDIVEQRTQFDSEPQK
FYETYQNEQEKLQETLVKAQNLLPLVDIERDLQVKISQVCSELDVDGLRGDIVVNRASKA
LAALEKRKSVTVEDISSIITLCLRHRLRKDPLETIDSGYKVKKVFNQIFGLEIEEN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgactttatcttcacctctgaacaatcatcgtaccgttttcccttttacagcaattatt
gggcaagatgaaatgaaattagccttgatgcttaatattatcgatccaaaaattggaggc
gtcatgatcatgggtgatcgtggaaccgggaaatctactactattagagcccttgcagat
ctacttcctgaaattgaagttgtcgaaaatgatccgtttaactctcatcctaccgatctt
gatcttatgggtgataacgcgcgtaaaacccttgaggaaaatggctcgttaataacgata
ccccaaaaagttactatggttgacttaccccttggtgctacagaagaccgtgtatgtgga
acaatagatatcgaaaaagctttgtcagagggagtaaaagcttttgaaccgggattatta
gccaaagctaatcgtggtattctttacgtagatgaagttaacctacttgatgaccactta
gttgatgtattacttgattcggctgcaagtggatggaatacagtagaaagagagggtatc
tctattagacatccagcccgttttgtattggtaggttctggaaatccagaggaaggagag
ttaagacctcaactacttgacagattcggaatgcatgctgaaattcgcacagttaaagat
ccctctttacgagtagatattgtagaacaaagaactcaatttgacagtgaacctcaaaaa
ttttatgaaacttatcagaacgaacaagaaaaactacaagaaaccttggtaaaagctcaa
aatttgttacctcttgtagatattgaacgtgacttacaggtaaaaatttctcaagtttgt
tctgaattagatgttgatggtttaagaggagatatagttgttaaccgtgcttcaaaagca
ttagcagcacttgaaaaacgcaaaagtgttacggtagaagatattagctcaataattaca
ttgtgtcttcgtcacaggttgcgcaaagatcctttggaaacaatagactcaggttataag
gttaaaaaagttttcaaccaaatatttggtcttgaaatagaagagaattaa

DBGET integrated database retrieval system