KEGG   Cyanobacterium UCYN-A: UCYN_02060Help
Entry
UCYN_02060        CDS       T01159                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UCYN_02060
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UCYN_02060
   00052 Galactose metabolism
    UCYN_02060
   00500 Starch and sucrose metabolism
    UCYN_02060
   00520 Amino sugar and nucleotide sugar metabolism
    UCYN_02060
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    UCYN_02060
   00524 Butirosin and neomycin biosynthesis
    UCYN_02060
Enzymes [BR:cyu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     UCYN_02060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
219941..220852
Genome map
AA seq 303 aa AA seqDB search
MKKSSVIGIDLGGTYIKIGQFLENGLCINFSTIETPRPATPEAVVTAITQIVKVLKKDCD
SIALGVGIPGPVDCTNRISKIAINLSNWKNVSLADLLEKHTQLPTVIENDANCAGLGEAW
LGAGKIYKNLIMLTLGTGVGGAIILDDQLFTGHLGTAGELGLITLDFNGPICKSGNRGSL
EQFGSIQAIRRMTGKDPAELGSLAKEGHKEAILFWEKYGQLLGAGLANIIYILTPEAIVI
GGGISGSMPFFLEATLKEIEQRVLPTSRTNLKLLEAKLGNKAGMLGAAKLAWNLVNNISN
KFN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcttcagtgataggaatcgaccttggtggaacctatattaaaattggacaa
tttcttgagaatggattatgtattaacttctcaacaatagaaactcccagacctgctact
cctgaagctgtagttacagctattacacagatagttaaagttttaaaaaaagattgtgat
tctatagctttaggggtcggaatacctggaccagtagattgtactaatagaatttctaaa
atagctataaatttatcaaactggaagaacgtttctttagcagacctattggaaaaacat
actcaattacctacagttatcgagaatgatgctaattgtgcaggtttaggagaagcttgg
ttaggtgcaggaaaaatctacaagaatttaataatgttaactttagggactggagttgga
ggagcaattattcttgatgatcagctatttacaggacatttaggaaccgcaggagagttg
ggattaatcaccttagattttaatggccctatctgtaaaagtggtaatagaggatcacta
gaacaatttggttcaattcaagcaattcgtcgtatgacaggcaaggatccagccgaactt
ggctctttagctaaggaaggacacaaggaagctattcttttctgggaaaaatacggacaa
ttactaggagcagggttagcaaatataatttatatattaactccagaagcaatagttata
ggtggtggaattagtggcagcatgccttttttcctcgaagctactttaaaagaaattgag
caacgtgttttgccaacttctcgtacgaatcttaaattattagaggcaaaattaggaaat
aaggcaggtatgcttggtgctgctaaacttgcctggaatcttgttaacaacatcagcaat
aagtttaattag

DBGET integrated database retrieval system