KEGG   Candidatus Atelocyanobacterium thalassa: UCYN_02060Help
Entry
UCYN_02060        CDS       T01159                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cyu  Candidatus Atelocyanobacterium thalassa
Pathway
cyu00010  Glycolysis / Gluconeogenesis
cyu00052  Galactose metabolism
cyu00500  Starch and sucrose metabolism
cyu00520  Amino sugar and nucleotide sugar metabolism
cyu00521  Streptomycin biosynthesis
cyu01100  Metabolic pathways
cyu01110  Biosynthesis of secondary metabolites
cyu01120  Microbial metabolism in diverse environments
cyu01130  Biosynthesis of antibiotics
cyu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UCYN_02060
   00052 Galactose metabolism
    UCYN_02060
   00500 Starch and sucrose metabolism
    UCYN_02060
   00520 Amino sugar and nucleotide sugar metabolism
    UCYN_02060
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    UCYN_02060
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    UCYN_02060
Enzymes [BR:cyu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     UCYN_02060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Fumerase
Motif
Other DBs
NCBI-ProteinID: ADB94955
UniProt: D3ENA5
Position
219941..220852
Genome map
AA seq 303 aa AA seqDB search
MKKSSVIGIDLGGTYIKIGQFLENGLCINFSTIETPRPATPEAVVTAITQIVKVLKKDCD
SIALGVGIPGPVDCTNRISKIAINLSNWKNVSLADLLEKHTQLPTVIENDANCAGLGEAW
LGAGKIYKNLIMLTLGTGVGGAIILDDQLFTGHLGTAGELGLITLDFNGPICKSGNRGSL
EQFGSIQAIRRMTGKDPAELGSLAKEGHKEAILFWEKYGQLLGAGLANIIYILTPEAIVI
GGGISGSMPFFLEATLKEIEQRVLPTSRTNLKLLEAKLGNKAGMLGAAKLAWNLVNNISN
KFN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcttcagtgataggaatcgaccttggtggaacctatattaaaattggacaa
tttcttgagaatggattatgtattaacttctcaacaatagaaactcccagacctgctact
cctgaagctgtagttacagctattacacagatagttaaagttttaaaaaaagattgtgat
tctatagctttaggggtcggaatacctggaccagtagattgtactaatagaatttctaaa
atagctataaatttatcaaactggaagaacgtttctttagcagacctattggaaaaacat
actcaattacctacagttatcgagaatgatgctaattgtgcaggtttaggagaagcttgg
ttaggtgcaggaaaaatctacaagaatttaataatgttaactttagggactggagttgga
ggagcaattattcttgatgatcagctatttacaggacatttaggaaccgcaggagagttg
ggattaatcaccttagattttaatggccctatctgtaaaagtggtaatagaggatcacta
gaacaatttggttcaattcaagcaattcgtcgtatgacaggcaaggatccagccgaactt
ggctctttagctaaggaaggacacaaggaagctattcttttctgggaaaaatacggacaa
ttactaggagcagggttagcaaatataatttatatattaactccagaagcaatagttata
ggtggtggaattagtggcagcatgccttttttcctcgaagctactttaaaagaaattgag
caacgtgttttgccaacttctcgtacgaatcttaaattattagaggcaaaattaggaaat
aaggcaggtatgcttggtgctgctaaacttgcctggaatcttgttaacaacatcagcaat
aagtttaattag

DBGET integrated database retrieval system