KEGG   Cyanobacterium UCYN-A: UCYN_02290Help
Entry
UCYN_02290        CDS       T01159                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UCYN_02290
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UCYN_02290
   00052 Galactose metabolism
    UCYN_02290
   00500 Starch and sucrose metabolism
    UCYN_02290
   00520 Amino sugar and nucleotide sugar metabolism
    UCYN_02290
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    UCYN_02290
   00524 Butirosin and neomycin biosynthesis
    UCYN_02290
Enzymes [BR:cyu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     UCYN_02290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250196..251239
Genome map
AA seq 347 aa AA seqDB search
MVLLLAGDIGGTKTILSLVESENVENGQKLPQQQRLYEKTYPSQDFVDLVPIVKHFCEEA
QLQLGSKIIVKNACFGIAGPVINNTSKLTNLNWFLTSSRLQEELFIDKVDLINDFVAISY
GILGLKDEDLYTLQDVEPKPKAPIAVLGAGTGLGEGFLIPLENEKYAAFPSEGSHADFAP
HNSLGYELSTYIKEKYNLSRISVERVVSGIGISTIYEFLRLKYPEQESEKMKIAYEAWKI
KKAINISATISKAAIENNDFLCQQAMGLFIESYGSEAGNLALKLLPYSGLYVAGGIAAKI
LPLMKSEAFINSFKSKGRMSSLLSEIPVHVILNPKVGLIGAALYAGQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggtcctattacttgctggagacatcggcggaaccaaaacaattttaagcttagttgag
tcagaaaatgttgaaaatggccaaaaattaccccagcaacaaagactatatgagaaaaca
tatcctagtcaagattttgtagaccttgtaccaatcgtaaagcatttttgcgaagaagca
cagcttcaactaggttcaaaaataatagtgaaaaacgcctgttttgggattgctggacca
gttattaataatacttcaaagctaactaatttaaattggtttttaactagtagtcgttta
caggaagaactttttatagataaagttgatttaattaatgattttgtagctattagctat
ggcatcttaggactaaaggatgaagatctatatactttacaagatgttgaaccaaagcca
aaagctcctattgctgttttaggagcgggtacaggactaggagaaggatttttaatacct
ttagagaatgaaaagtatgccgctttcccttctgaaggttctcatgctgattttgcacca
cacaatagtttaggatatgaattatcaacatatattaaagaaaaatataacttatctagg
atatcagttgaaagagtagtttctggaataggaattagtacaatatacgaatttttacgc
ctaaaataccctgaacaagagtcagaaaagatgaagatagcttatgaagcttggaaaatc
aaaaaagctattaatatttcagcaaccatatctaaagctgctatagaaaataatgatttt
ctatgtcagcaagcaatgggactcttcatcgaatcttatggttcagaagcaggtaatctt
gctttaaaacttctaccatatagtggattatatgttgctggaggaatagctgcaaaaata
ttacccttgatgaaaagtgaggcatttataaactcatttaaatctaaaggaaggatgagt
tctcttttgtctgaaattcctgtgcacgtaatattgaatccaaaagttggcttgattggt
gctgcattatatgcagggcagtaa

DBGET integrated database retrieval system