KEGG   Cyanobacterium UCYN-A: UCYN_02290Help
Entry
UCYN_02290        CDS       T01159                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cyu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cyu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cyu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cyu00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cyu00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cyu00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250196..251239
Genome map
AA seq 347 aa AA seqDB search
MVLLLAGDIGGTKTILSLVESENVENGQKLPQQQRLYEKTYPSQDFVDLVPIVKHFCEEA
QLQLGSKIIVKNACFGIAGPVINNTSKLTNLNWFLTSSRLQEELFIDKVDLINDFVAISY
GILGLKDEDLYTLQDVEPKPKAPIAVLGAGTGLGEGFLIPLENEKYAAFPSEGSHADFAP
HNSLGYELSTYIKEKYNLSRISVERVVSGIGISTIYEFLRLKYPEQESEKMKIAYEAWKI
KKAINISATISKAAIENNDFLCQQAMGLFIESYGSEAGNLALKLLPYSGLYVAGGIAAKI
LPLMKSEAFINSFKSKGRMSSLLSEIPVHVILNPKVGLIGAALYAGQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggtcctattacttgctggagacatcggcggaaccaaaacaattttaagcttagttgag
tcagaaaatgttgaaaatggccaaaaattaccccagcaacaaagactatatgagaaaaca
tatcctagtcaagattttgtagaccttgtaccaatcgtaaagcatttttgcgaagaagca
cagcttcaactaggttcaaaaataatagtgaaaaacgcctgttttgggattgctggacca
gttattaataatacttcaaagctaactaatttaaattggtttttaactagtagtcgttta
caggaagaactttttatagataaagttgatttaattaatgattttgtagctattagctat
ggcatcttaggactaaaggatgaagatctatatactttacaagatgttgaaccaaagcca
aaagctcctattgctgttttaggagcgggtacaggactaggagaaggatttttaatacct
ttagagaatgaaaagtatgccgctttcccttctgaaggttctcatgctgattttgcacca
cacaatagtttaggatatgaattatcaacatatattaaagaaaaatataacttatctagg
atatcagttgaaagagtagtttctggaataggaattagtacaatatacgaatttttacgc
ctaaaataccctgaacaagagtcagaaaagatgaagatagcttatgaagcttggaaaatc
aaaaaagctattaatatttcagcaaccatatctaaagctgctatagaaaataatgatttt
ctatgtcagcaagcaatgggactcttcatcgaatcttatggttcagaagcaggtaatctt
gctttaaaacttctaccatatagtggattatatgttgctggaggaatagctgcaaaaata
ttacccttgatgaaaagtgaggcatttataaactcatttaaatctaaaggaaggatgagt
tctcttttgtctgaaattcctgtgcacgtaatattgaatccaaaagttggcttgattggt
gctgcattatatgcagggcagtaa

DBGET integrated database retrieval system