KEGG   Cyanobacterium UCYN-A: UCYN_02300Help
Entry
UCYN_02300        CDS       T01159                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UCYN_02300
  Amino acid metabolism
   00330 Arginine and proline metabolism
    UCYN_02300
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    UCYN_02300
Enzymes [BR:cyu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     UCYN_02300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
251266..252396
Genome map
AA seq 376 aa AA seqDB search
MSYKHTIVVKIGTSNLTQPETRKLVLSTINSLVKTLTKLRQLGHNVVLVSSGAVGVGCSR
LKVKETPKKISLKQAIAAVGQGRLMHVYDELFTSIDQPIAQILLTRRELMERSCYINARN
TFNALFKLGVIPIVNENDTVAIEELKFGDNDTLSASVASLINADWLFILTDVDYLYSADP
RLFPDAQPISNVDSVQLAKLQVQANSTGSQWGTGGMLTKLTAAKLATKAGITTVITNGKY
PENLIKILDGEDIGTKFGAYLENDNARKRWISYGLLPTGKLYLNEESIIAISQKGKSLLV
ADVIRVEGNFKSFEAVRLCNEGGEEVARGIVNYSKHEIDKINKNRLDNISQLPTCDGYET
IVHKNNLVISKKNIRL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagttataagcatacaattgttgtcaagattggtacctccaatcttacccaaccagag
acaagaaaattagttttatcgacaattaattctttagttaaaacattaactaagttaagg
caattaggtcataatgttgttctagtttcctcaggagctgttggagtaggttgtagtcgt
ctaaaagtaaaagaaacaccaaaaaaaatttctttaaaacaagcgattgctgcagtgggc
caaggaagattaatgcacgtatacgatgagctttttacttcaatagatcaaccaatagca
caaattctattaactcgaagagaattaatggaaagaagctgttatatcaatgctagaaat
acttttaatgcattattcaagttaggtgtaattcctatcgttaatgaaaatgatacagtt
gccattgaagaattaaagtttggtgataatgacactctctctgcctcagtcgcaagttta
atcaatgcagattggttatttatactaacagatgttgattatctttattctgctgatcca
cgtttatttcctgacgctcaacctattagtaatgttgatagtgtacagctagctaaatta
caagttcaagctaatagcacaggatctcaatggggaacaggaggaatgctgactaagtta
acggcggcaaaattagctaccaaagcaggaataacaacagttatcaccaatggaaagtat
ccagaaaacttaatcaaaattcttgatggcgaagatatcggaactaaatttggtgcttat
ttagaaaacgataatgctcgaaaacgctggatttcttatggtttattacctacaggaaaa
ctttatcttaatgaagagtcaattatagcaatttctcaaaaaggaaaatcattattagta
gcagatgtaataagggtcgaaggtaatttcaagtcttttgaagcagttaggttatgtaat
gagggaggagaggaagtagcaagaggaatagttaattatagtaaacatgaaattgataaa
ataaataaaaatcgtttagataatatatctcaattaccaacttgtgatggatatgagaca
attgtgcataaaaataacttagtcattagcaaaaaaaatatcagactataa

DBGET integrated database retrieval system