KEGG   Cyanobacterium UCYN-A: UCYN_02330Help
Entry
UCYN_02330        CDS       T01159                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UCYN_02330
Enzymes [BR:cyu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     UCYN_02330
Exosome [BR:cyu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UCYN_02330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255645..256631
Genome map
AA seq 328 aa AA seqDB search
MFPLNRPRRLRTNQRLRDMVCETKLTLDDLIYPLFAVPGNNIAKEVISMPGIFQLSIDKI
VNEAKMVRDLGIPAIILFGVPEEKNSEATGAWGKEGIVQRATEAIKREVKDLIVIVDTCV
CEYTDHGHCGYLKKDDCTGEVLNDSTLELLKKTAVSQALAGADIIAPSGMMDGFVRSIRE
KLDQEGFSNIPILSYAAKYASGYYGPFRDAADSSPQFGDRRTYQMDPGNAREALKEVMLD
IEEGADMLMVKPALSYMDILWRIKEMTNLPVAAYNVSGEYSMIKAAAANGWIDEKQVTLE
TLTSFKRAGADLILTYHAKDVARWIQSK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctcttaaccgtcctcgtcgtttacgcaccaatcaaagattacgtgacatggta
tgtgaaacaaaattaacattagatgacctaatttatcccttattcgcagttccaggaaac
aatattgctaaagaagtaatatctatgcctggtattttccagttatcgatagataaaatt
gtgaatgaagcaaaaatggttcgcgatttagggattccagcaattattctttttggagtt
ccagaagaaaagaattcagaagctacaggtgcatggggtaaagaaggtatagtacagcga
gctactgaagcaattaaaagagaagttaaagatctaatagttattgttgatacttgtgta
tgcgaatatactgatcatgggcattgcggatatttaaagaaggatgattgcactggagaa
gttttaaacgattcaactttagagttattaaaaaagactgccgtttctcaagctcttgcc
ggagctgatataattgcaccatcaggaatgatggatggttttgtaaggtctattagagaa
aagttagatcaagagggttttagtaatattcctatattatcttatgcagctaagtatgct
tctggttattatggaccatttcgagatgctgcagattcatctccacaatttggtgatcgt
agaacttaccaaatggatcctggaaatgctagagaagcattaaaagaagttatgttagac
attgaagaaggagcagacatgttaatggttaaacctgcattatcatacatggatatcctg
tggaggatcaaggaaatgactaatcttcctgtcgctgcatacaacgtttctggagaatac
tcaatgattaaagcggcagcagctaatggatggatagatgaaaagcaggttacattggaa
accttaactagttttaaaagagctggtgcagatcttattttaacctatcatgcaaaagac
gttgctcgctggattcagtcaaaatag

DBGET integrated database retrieval system