KEGG   Cyanobacterium UCYN-A: UCYN_02960Help
Entry
UCYN_02960        CDS       T01159                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase/Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    UCYN_02960
Enzymes [BR:cyu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     UCYN_02960
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     UCYN_02960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319138..319992
Genome map
AA seq 284 aa AA seqDB search
MPELPEVESICRKLNELTTGQTILGGQVLLARSLAYPSSMQEFLNLIDNVDLKIWKRRGK
YLLAELDSNKGWIVFHLRMTGQLLLTQQSEPLSKHTRLRLFCKNSYELRFIDIRTFGKVW
VIPPSYNPEDIITGLKKLGVEPFSNDFSINYLIENLTRYKRNIKTILLDQSIIAGIGNIY
ADEALFRSNIHPETKGAELTLKQIKNLQKAILEVLSKSIDEGGTTFSDFLNITGNKGNYT
EFAWVYGRNHSPCRICSTPIKRIKLNGRSSHFCPKCQQYSNLFK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgccagaattacccgaagttgagagtatttgtcggaaactcaatgaattaactaccggc
caaactattttgggaggacaagtgttgttagcacgttcacttgcctacccttcttctatg
caagaatttttaaatttgattgataatgttgatttaaaaatatggaagagaagaggaaaa
tatttattagcagaattagatagtaataaaggctggatagtatttcatcttagaatgaca
ggtcaacttttattgactcagcaaagtgaaccattatcaaagcacactcgactacgatta
ttttgcaaaaactcttatgagttaagatttatagatatcagaacttttggaaaggtatgg
gtaattccaccatcctataatccagaagatataatcactggcctaaaaaaattaggtgta
gaacctttctcaaatgatttttcaattaattatcttattgaaaatttaacaagatataag
cgtaatatcaaaactatcttattagatcaatcaatcattgcaggaattggtaatatatat
gctgatgaagctctatttcgaagtaatattcatcccgaaactaaaggtgcagagttaact
ctcaaacaaattaagaatttacaaaaggctattcttgaagttcttagtaaatctattgat
gaaggaggaactacctttagtgattttttaaatattactggtaataaaggtaactataca
gaatttgcttgggtttatggcagaaaccattctccttgtcgtatttgtagtactcccatt
aagcgcattaagttaaacggtagatcttcccatttttgcccaaaatgccaacaatatagt
aacttgttcaaatag

DBGET integrated database retrieval system