KEGG   Cyanobacterium UCYN-A: UCYN_02960Help
Entry
UCYN_02960        CDS       T01159                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase/Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cyu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319138..319992
Genome map
AA seq 284 aa AA seqDB search
MPELPEVESICRKLNELTTGQTILGGQVLLARSLAYPSSMQEFLNLIDNVDLKIWKRRGK
YLLAELDSNKGWIVFHLRMTGQLLLTQQSEPLSKHTRLRLFCKNSYELRFIDIRTFGKVW
VIPPSYNPEDIITGLKKLGVEPFSNDFSINYLIENLTRYKRNIKTILLDQSIIAGIGNIY
ADEALFRSNIHPETKGAELTLKQIKNLQKAILEVLSKSIDEGGTTFSDFLNITGNKGNYT
EFAWVYGRNHSPCRICSTPIKRIKLNGRSSHFCPKCQQYSNLFK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgccagaattacccgaagttgagagtatttgtcggaaactcaatgaattaactaccggc
caaactattttgggaggacaagtgttgttagcacgttcacttgcctacccttcttctatg
caagaatttttaaatttgattgataatgttgatttaaaaatatggaagagaagaggaaaa
tatttattagcagaattagatagtaataaaggctggatagtatttcatcttagaatgaca
ggtcaacttttattgactcagcaaagtgaaccattatcaaagcacactcgactacgatta
ttttgcaaaaactcttatgagttaagatttatagatatcagaacttttggaaaggtatgg
gtaattccaccatcctataatccagaagatataatcactggcctaaaaaaattaggtgta
gaacctttctcaaatgatttttcaattaattatcttattgaaaatttaacaagatataag
cgtaatatcaaaactatcttattagatcaatcaatcattgcaggaattggtaatatatat
gctgatgaagctctatttcgaagtaatattcatcccgaaactaaaggtgcagagttaact
ctcaaacaaattaagaatttacaaaaggctattcttgaagttcttagtaaatctattgat
gaaggaggaactacctttagtgattttttaaatattactggtaataaaggtaactataca
gaatttgcttgggtttatggcagaaaccattctccttgtcgtatttgtagtactcccatt
aagcgcattaagttaaacggtagatcttcccatttttgcccaaaatgccaacaatatagt
aacttgttcaaatag

DBGET integrated database retrieval system