KEGG   Cyanobacterium UCYN-A: UCYN_03430Help
Entry
UCYN_03430        CDS       T01159                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UCYN_03430
DNA repair and recombination proteins [BR:cyu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      UCYN_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(370438..370995)
Genome map
AA seq 185 aa AA seqDB search
MQRLPGIGPKSAQRLAFYILKLPESEVQAFAKALINAKQRTGLCTKCFHFSEKPICEICS
NTNRDSNLICVVADSRDVIALEKTREYKGMYHVLGGIMSPIDGIGPEQLNVEPLVRRVSQ
ENIKEVILAISPTVEGETMTLYLCQVLKAFTKVTRIAFGLPVGGDLEYTDEITLARALAG
RQELS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacgcttgccaggaattggtcctaaatcagcacaaagattagctttttatattctt
aaactacccgagtctgaagttcaagcctttgctaaagctttaataaatgcaaaacaacgt
acaggtttatgtacaaaatgttttcatttctcagaaaaacctatctgtgagatttgtagt
aatacgaatagagattcaaatcttatatgtgtcgtagctgattctcgagatgttatcgct
ctagaaaaaactagagaatataaaggaatgtaccatgtactaggaggaatcatgtctcct
atagatggtattggtccagagcaacttaacgttgagccattagtaaggcgtgtatctcag
gaaaatataaaagaagtaatcctagcaattagtccaacagttgaaggagaaactatgact
ctatacctttgtcaggtactaaaagctttcacaaaagttacacgtattgcttttggttta
ccagtaggtggagacttagaatatacagatgaaataactttagcgagagctttggctggc
cgacaagagctgagttaa

DBGET integrated database retrieval system