KEGG   Cyanobacterium UCYN-A: UCYN_05380Help
Entry
UCYN_05380        CDS       T01159                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UCYN_05380
   01230 Biosynthesis of amino acids
    UCYN_05380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UCYN_05380
   00051 Fructose and mannose metabolism
    UCYN_05380
   00562 Inositol phosphate metabolism
    UCYN_05380
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    UCYN_05380
Enzymes [BR:cyu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UCYN_05380
Exosome [BR:cyu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UCYN_05380
  Exosomal proteins of bladder cancer cells
   UCYN_05380
  Exosomal proteins of melanoma cells
   UCYN_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604416..605138
Genome map
AA seq 240 aa AA seqDB search
MRKKIIAGNWKMHKTQAEALEFLSVLKLNLANTTEKADIVLCVPFTLLSLLSKSLHGGNI
HLGAQNIHWANEGAFTGEISGSMLVDLNANYVIVGHSERRQYFGETDKIVNEKVIAAQYH
KIKPILCVGETKKQRDAGEVEKVIVKQLEQSLVNVDQGNLVIAYEPIWAIGTGETCNVLE
ANRIIGIIREQVTNKGITIQYGGSVTPKNISEIMTQPNIDGVLVGGASLNPLSFSEIINY
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaaaaatcattgcaggtaattggaaaatgcataaaactcaggcagaagcccta
gagtttttatcagtattaaaacttaatttagcaaacacaacagagaaagcagatattgtt
ctttgtgtcccatttactttgttaagtcttttgtcgaaaagtttacatggaggaaatatt
cacttaggtgcacaaaatatacattgggctaatgagggagcttttacaggcgagatttct
ggttcaatgttagtagatctaaatgcaaactatgtaatagtcggtcatagtgaacgtcgt
caatattttggagaaacagataaaatcgttaatgaaaaagttatagcagctcagtatcat
aaaataaaaccgattctctgtgttggagaaactaaaaagcagagagatgcaggggaggta
gaaaaagttattgttaaacagttagaacaaagtttagttaatgtagatcaaggaaattta
gttattgcctatgaacccatatgggctatcggtacaggagaaacttgtaatgttttggaa
gctaatcgcataattggcatcatacgtgaacaagtaacaaataaaggtattaccattcaa
tatggtggctctgttacgcctaaaaatattagcgaaataatgactcaacctaatatcgat
ggagttctggtgggaggagcaagtctaaatcctcttagcttttctgaaattataaattat
taa

DBGET integrated database retrieval system