KEGG   Cyanobacterium UCYN-A: UCYN_05530Help
Entry
UCYN_05530        CDS       T01159                                 

Definition
Delta-9 acyl-phospholipid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    UCYN_05530
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    UCYN_05530
Enzymes [BR:cyu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     UCYN_05530
Lipid biosynthesis proteins [BR:cyu01004]
 Desaturase
  First
   UCYN_05530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
617679..618503
Genome map
AA seq 274 aa AA seqDB search
MIVTTSKKLPRDWTIIVYMILIHSFALFALSPSNFSWGAVGIAIFFYWVTGALGITLGFH
RLVSHRSFQTPKWLEYLLVFCGTLACQGGVIQWVGLHRIHHKFSDTKSDPHDSKRGFWWS
HMGWIIHKIPADKYISLYTQDISEDHFYKFCQIFMIPIQLFLGVFLYFLGGKAFVVWGIF
VRLVVVLHFTWFVNSATHKFGYQSYKSNDNSRNCWWVALLTFGEGWHNNHHAYQYSARHG
ITWWEIDITWITIKFLRFLGLAKNVKLAPKSSNI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgattgttaccacatcgaaaaaacttccccgtgactggacaattattgtttatatgatt
ttaattcattccttcgcattatttgctttatcaccaagcaactttagttggggagctgtt
ggtatagctatttttttttattgggtcacaggagctttgggaatcacgttaggttttcat
agattagtttctcatcgtagttttcaaactcctaaatggctagaatatttattagttttt
tgtggaacattagcttgtcaaggcggagttattcagtgggttggtttgcatcgtattcac
cacaaattttctgatacgaagtcagatcctcatgattccaaacgcggattctggtggagt
cacatgggatggataatacataaaattcctgcagataaatatatttctctttacactcaa
gatattagtgaagatcatttttataagttttgtcaaattttcatgattccaattcaactt
tttcttggagtatttctttacttcttaggaggaaaagcttttgtagtatggggtatattt
gttcgtttagtagttgttctccattttacttggtttgttaatagtgctactcataaattt
ggatatcaaagctataagtctaatgacaattctcgtaactgctggtgggtagcattattg
acttttggagaggggtggcataataaccatcatgcctatcaatattctgctcgtcatgga
ataacttggtgggaaattgatattacttggataactattaaatttcttaggtttttagga
ttggctaaaaatgtaaaattagctcctaaaagtagcaatatataa

DBGET integrated database retrieval system