KEGG   Cyanobacterium UCYN-A: UCYN_05670Help
Entry
UCYN_05670        CDS       T01159                                 

Definition
arginase/agmainase/formiminoglutamate hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    UCYN_05670
Enzymes [BR:cyu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     UCYN_05670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634173..635210
Genome map
AA seq 345 aa AA seqDB search
MNNRNKSLLDFNPSSIGIENGNLYGLPYFYENSGIIVFGIPWEVTVSYKTGTGLGPLRVL
EASPQLDLYDLDNPHGWKQGIFMPSISQFLLTLNQKFRKKALKIIEATEKNIDIKSCEQL
QQELISVNSACQKMVDWVDEQASAAIQVGKKVGIVGGDHSVPLGYIQALARHNNDFGILH
IDAHADLRVDYQGFYYSHASIMNNVLKIPQVIKLVQVGIRDFCEEETVIIRSSNNRIITY
YDSYLKKSRYEGVSWYEQCQKIISNLPEQVYISFDLDGLDPKLCPHTGTPVAGGLNLEAV
FYLLKQVIDSNRKIIGFDVSEVGNGEWDGNVGARIIYKLCCLLGL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgaaataagagcctattagattttaatccgagtagtattggaatagaaaat
ggtaatttatacggattaccttatttttatgaaaattctggaattattgtttttggtatc
ccctgggaggtaacggtctcttataaaactggtacaggattgggaccattaagggtgctg
gaagcttctccccagctggatctttatgatttagacaatcctcatggttggaagcaagga
atttttatgccatcaatttcgcaatttttattaacacttaaccaaaaatttagaaagaaa
gccttaaaaataatcgaggcaactgaaaaaaatatagatatcaaaagttgtgaacaacta
caacaagaattaataagtgttaattctgcttgccagaaaatggtggattgggtagatgaa
caagctagtgctgctattcaagtagggaaaaaagttggtattgttggtggagatcatagt
gttccacttgggtatattcaagccttagctagacacaataatgattttggaattcttcat
attgatgcacatgctgatttaagagtagattaccaaggattttattattctcatgcttca
attatgaataatgtactaaaaatacctcaagttattaaattagttcaagttggaattcga
gatttttgcgaagaagaaacagttattattagatcatctaataaccgaataattacctat
tatgattcctatttaaaaaagtctcgatatgagggcgtaagttggtatgaacaatgccaa
aaaattattagcaacttacctgagcaagtttatattagtttcgatttagatggtttagat
cctaaattatgtcctcatacaggaacccctgtagctggtggattaaatttagaagcagta
ttttatttattaaaacaagtaattgatagtaatagaaaaataattgggtttgatgtttct
gaagtgggtaatggtgaatgggacggaaatgtcggagctagaataatatataagttatgt
tgcttattaggtttgtaa

DBGET integrated database retrieval system