KEGG   Candidatus Atelocyanobacterium thalassa: UCYN_06570Help
Entry
UCYN_06570        CDS       T01159                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cyu  Candidatus Atelocyanobacterium thalassa
Pathway
cyu00790  Folate biosynthesis
cyu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UCYN_06570
Enzymes [BR:cyu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     UCYN_06570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DNA_binding_1
Motif
Other DBs
NCBI-ProteinID: ADB95356
UniProt: D3EPF6
Position
complement(738263..738724)
Genome map
AA seq 153 aa AA seqDB search
MKFLTEGYNQSLTQLVNEAIFDEGHNEMVLIRDINFFSLCEHHMLPFMGRAHVAYIPDGK
VIGLSKIARIVEMYSRRLQVQERLTRQIANAMQEVLKPLGVAVVMEATHMCMVMRGVQKP
GSWTLTSTMLGKFNEEQKTREEFLNSVRHQPKF
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctaacagaaggttataatcaatccttgactcaattagttaatgaagctatt
tttgatgaaggacataatgaaatggttttaataagagatattaactttttcagtttatgt
gaacatcatatgttgccatttatgggacgcgctcacgttgcctatataccggatggaaag
gtaattggattgagtaaaatagccagaattgtagaaatgtattcacgccgcttacaagta
caagaacgtttgactcgtcaaattgctaatgctatgcaagaagttttgaaacctctaggt
gttgcagttgtcatggaagcaactcatatgtgtatggtgatgagaggagtgcaaaagcct
ggatcttggaccttgactagtaccatgttgggtaaatttaatgaagaacaaaaaacacga
gaagagtttcttaattcagtacgtcatcaaccaaagttttaa

DBGET integrated database retrieval system