KEGG   Cyanobacterium UCYN-A: UCYN_06570Help
Entry
UCYN_06570        CDS       T01159                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(738263..738724)
Genome map
AA seq 153 aa AA seqDB search
MKFLTEGYNQSLTQLVNEAIFDEGHNEMVLIRDINFFSLCEHHMLPFMGRAHVAYIPDGK
VIGLSKIARIVEMYSRRLQVQERLTRQIANAMQEVLKPLGVAVVMEATHMCMVMRGVQKP
GSWTLTSTMLGKFNEEQKTREEFLNSVRHQPKF
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctaacagaaggttataatcaatccttgactcaattagttaatgaagctatt
tttgatgaaggacataatgaaatggttttaataagagatattaactttttcagtttatgt
gaacatcatatgttgccatttatgggacgcgctcacgttgcctatataccggatggaaag
gtaattggattgagtaaaatagccagaattgtagaaatgtattcacgccgcttacaagta
caagaacgtttgactcgtcaaattgctaatgctatgcaagaagttttgaaacctctaggt
gttgcagttgtcatggaagcaactcatatgtgtatggtgatgagaggagtgcaaaagcct
ggatcttggaccttgactagtaccatgttgggtaaatttaatgaagaacaaaaaacacga
gaagagtttcttaattcagtacgtcatcaaccaaagttttaa

DBGET integrated database retrieval system