KEGG   Cyanobacterium UCYN-A: UCYN_07100Help
Entry
UCYN_07100        CDS       T01159                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UCYN_07100
Enzymes [BR:cyu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     UCYN_07100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(807192..807833)
Genome map
AA seq 213 aa AA seqDB search
MINYFKGSFVEILKDTKNKIVLIMEVNQIGYEIQITSKLEEKLSNKKSDYIQVFIHLQTR
EDSQILYGFINKLEQELFRQLININGIGAQLSITLLNTLGSEKLIKAVCSGNVKMLSESP
GVGKKTAERIILELNSKLLKLIEAFEIKVELHSCNSSENTLEDITSSLLLLGYDREGVDR
VTVYLKNNQFLSKQINTEELLRTAITWLSDNSH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgattaactattttaaaggaagttttgttgaaatcctaaaagataccaaaaataaaata
gttctaattatggaggttaatcagataggatatgaaatacaaatcacttccaagttagaa
gaaaaattatctaataaaaaatcagattatattcaagtgtttatacatttacagacacga
gaagattctcagattttatatggatttattaataaattagagcaagagctttttcgacaa
ctcataaatattaatggtattggagcgcagctatcaattactttacttaacacattgggt
tcagaaaaattaataaaggcagtgtgttcgggtaatgtcaaaatgttatctgaatctcct
ggcgtaggtaaaaaaacggctgaaagaataattttagaattaaatagtaaattattaaaa
ttgatagaggcatttgaaataaaagtagaattgcattcttgcaattcatctgaaaatact
ttagaagatattacatcaagcttattgttattaggttatgatcgagaaggagtagacagg
gtgactgtttacttaaaaaataatcagtttctatcaaagcaaataaatacagaagaatta
ttaagaacagcaattacttggttaagtgacaatagtcattaa

DBGET integrated database retrieval system