KEGG   Candidatus Atelocyanobacterium thalassa: UCYN_07300Help
Entry
UCYN_07300        CDS       T01159                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cyu  Candidatus Atelocyanobacterium thalassa
Pathway
cyu00230  Purine metabolism
cyu01100  Metabolic pathways
Module
cyu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    UCYN_07300
Enzymes [BR:cyu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     UCYN_07300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase AAA_22 AAA_16 MMR_HSR1 ABC_tran AAA NTPase_1 AAA_18 AAA_17 AAA_5 AAA_29 AAA_14
Motif
Other DBs
NCBI-ProteinID: ADB95426
UniProt: D3EPM6
Position
832235..832786
Genome map
AA seq 183 aa AA seqDB search
MSGKLVVLTGPSGVGKGTIVHSLLNRYPDLYLSISATTRSPRAGEIHGKDYYFVNNEKFE
EMIRQNQLLEWAQYAGNYYGTPRLNIEDKISKGFIVLLEIEVAGAKTIKKTFSNVLRIFI
LPPSLTELENRLRGRATDSEQAIKKRLKLAKEELAVSQEFDKVIINSNLEKTLEQLELII
FSA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcaaacttgttgtattaactggccctagcggtgtaggaaaaggcacaatagtg
cattctctgttaaatcgttatccagatctttatttatcaatttccgcgaccactcgctct
ccacgtgctggagaaattcatgggaaggactattatttcgtcaacaatgaaaaatttgaa
gaaatgattcgacaaaatcaactactagaatgggctcaatatgctggaaactattatggg
acaccacgtcttaatattgaagataaaattagtaaaggatttattgttcttttagagata
gaggttgctggagcaaaaacaatcaaaaaaactttttctaatgttttaagaatctttata
ttaccaccttctctcacagaactcgaaaatcgtttaagaggtagagcaactgattctgaa
caagctattaaaaaacggctcaaacttgcaaaagaagaattagcagttagtcaagaattc
gacaaggtaattattaatagcaacttagagaaaacattagagcaattggaattaattata
ttttctgcataa

DBGET integrated database retrieval system