KEGG   Cyanobacterium UCYN-A: UCYN_07300Help
Entry
UCYN_07300        CDS       T01159                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    UCYN_07300
Enzymes [BR:cyu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     UCYN_07300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
832235..832786
Genome map
AA seq 183 aa AA seqDB search
MSGKLVVLTGPSGVGKGTIVHSLLNRYPDLYLSISATTRSPRAGEIHGKDYYFVNNEKFE
EMIRQNQLLEWAQYAGNYYGTPRLNIEDKISKGFIVLLEIEVAGAKTIKKTFSNVLRIFI
LPPSLTELENRLRGRATDSEQAIKKRLKLAKEELAVSQEFDKVIINSNLEKTLEQLELII
FSA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcaaacttgttgtattaactggccctagcggtgtaggaaaaggcacaatagtg
cattctctgttaaatcgttatccagatctttatttatcaatttccgcgaccactcgctct
ccacgtgctggagaaattcatgggaaggactattatttcgtcaacaatgaaaaatttgaa
gaaatgattcgacaaaatcaactactagaatgggctcaatatgctggaaactattatggg
acaccacgtcttaatattgaagataaaattagtaaaggatttattgttcttttagagata
gaggttgctggagcaaaaacaatcaaaaaaactttttctaatgttttaagaatctttata
ttaccaccttctctcacagaactcgaaaatcgtttaagaggtagagcaactgattctgaa
caagctattaaaaaacggctcaaacttgcaaaagaagaattagcagttagtcaagaattc
gacaaggtaattattaatagcaacttagagaaaacattagagcaattggaattaattata
ttttctgcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system