KEGG   Cyanobacterium UCYN-A: UCYN_09700Help
Entry
UCYN_09700        CDS       T01159                                 

Definition
uroporphyrinogen-III synthase/uroporphyrinogen-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cyu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1107494..1109008)
Genome map
AA seq 504 aa AA seqDB search
MTGKIFFVGSGVFNISYLTLRGYYLLSNAEVVIYDTLIDSSLLELVPVNCLKIYVGKRRG
KLSTHQKYINNLLVNHCLLGKKIVRLKGGDPSLFGRLTEEVYALTQANCKYEIIPGISSA
LAAPVLAGIPITDKKISQCFTILTGHDLTILDWETLARSNTLIILMGIKNLSKIIDKLII
NGKSSNESVAIVHNCGSSNQITITGTLKTIVDKIAANYLSPAIIIIGEVVKLRNMPSSSN
LPLAGKKVIITRSHESSSQFKFQLQEAGADVITLPLLEILPPSSWERLDGAIQEISSFDW
LVLTSANGVKFFMERLHDLGKDIRILNNIKIAVVGKKTADYLKKFYLKPNFIPSDFIADS
LVENFPEDINGKKILFPRVETGGRDILLKEFIKKGASITEVPAYQSICPKNIDNEIWKIL
KNEQVDIITFTSSKIVKHFYHLFKNIFPDSIEEKKILSKLDNVYLACIGPQTSKTCNDLF
GRVDVEAKEYTLEGLTNQLIDYFS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcaaaatattctttgtaggttcaggagtatttaatatatcttatttgactctt
aggggatattatttactatctaatgcagaagtagtaatatatgacactttaattgattcg
agtttattagaattggtaccagttaattgcctcaaaatttatgttggaaaacgtcgaggt
aaattaagtactcatcaaaaatatattaataacttattagtaaatcattgtttgttaggg
aagaaaatagtaaggttaaaaggaggtgatccttccttattcgggcgtcttacagaagaa
gtatatgccttaacgcaagctaattgtaagtacgaaataattcctggtatttcttcagca
ttggcagctcctgtattagctggaattccaattactgataaaaaaataagtcaatgcttc
acaatattaacgggacatgacttaaccatattagactgggaaacattagctagaagtaat
acactaataattctgatgggaataaagaatcttagtaaaattattgataaattaataatt
aatggtaagtcttcaaatgaatcggttgcaatcgttcataattgcggaagttccaatcag
ataacaattacaggaacactaaaaactatagttgataagattgcagctaattatttatct
ccagctattatcataattggagaagtagtaaaattaagaaatatgccatcgtcttctaat
ctccccttagcaggtaaaaaagtaataataactcgttctcatgagtcttctagtcaattt
aaatttcagttgcaagaagctggagcagatgttatcacactacctttgttagaaatacta
ccaccttcttcttgggaaagactagatggagcaattcaagaaatttcatcttttgattgg
ctggttttgacttctgcaaatggggtgaagttttttatggaaagattacatgacttagga
aaagatattcgtattttaaataatattaaaattgctgttgttggtaaaaaaacagctgat
tatttaaagaaattttacttaaaacctaattttataccttctgattttattgctgattca
ttagttgaaaattttccagaagatatcaatggtaaaaagatcttatttcctagggtagag
acaggaggaagagatatacttttaaaagaatttataaaaaaaggggctagtatcactgaa
gtccctgcttatcaatcaatttgccctaaaaatattgataatgaaatatggaaaatatta
aaaaatgagcaagtagatataattacttttactagttctaaaattgttaaacatttctat
catttattcaagaatatatttcctgatagtatagaagaaaaaaagatcttatctaaatta
gataatgtttatctagcatgtattggacctcaaacttcaaaaacctgcaatgatttattt
ggcagagttgatgttgaagcaaaagaatacacgttagaaggcttaactaaccaattaatt
gattacttttcatag

DBGET integrated database retrieval system