KEGG   Candidatus Atelocyanobacterium thalassa: UCYN_09700Help
Entry
UCYN_09700        CDS       T01159                                 

Definition
(GenBank) uroporphyrinogen-III synthase/uroporphyrinogen-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cyu  Candidatus Atelocyanobacterium thalassa
Pathway
cyu00860  Porphyrin and chlorophyll metabolism
cyu01100  Metabolic pathways
cyu01110  Biosynthesis of secondary metabolites
cyu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UCYN_09700
Enzymes [BR:cyu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     UCYN_09700
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     UCYN_09700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ADB95649
UniProt: D3EQ99
Position
complement(1107494..1109008)
Genome map
AA seq 504 aa AA seqDB search
MTGKIFFVGSGVFNISYLTLRGYYLLSNAEVVIYDTLIDSSLLELVPVNCLKIYVGKRRG
KLSTHQKYINNLLVNHCLLGKKIVRLKGGDPSLFGRLTEEVYALTQANCKYEIIPGISSA
LAAPVLAGIPITDKKISQCFTILTGHDLTILDWETLARSNTLIILMGIKNLSKIIDKLII
NGKSSNESVAIVHNCGSSNQITITGTLKTIVDKIAANYLSPAIIIIGEVVKLRNMPSSSN
LPLAGKKVIITRSHESSSQFKFQLQEAGADVITLPLLEILPPSSWERLDGAIQEISSFDW
LVLTSANGVKFFMERLHDLGKDIRILNNIKIAVVGKKTADYLKKFYLKPNFIPSDFIADS
LVENFPEDINGKKILFPRVETGGRDILLKEFIKKGASITEVPAYQSICPKNIDNEIWKIL
KNEQVDIITFTSSKIVKHFYHLFKNIFPDSIEEKKILSKLDNVYLACIGPQTSKTCNDLF
GRVDVEAKEYTLEGLTNQLIDYFS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcaaaatattctttgtaggttcaggagtatttaatatatcttatttgactctt
aggggatattatttactatctaatgcagaagtagtaatatatgacactttaattgattcg
agtttattagaattggtaccagttaattgcctcaaaatttatgttggaaaacgtcgaggt
aaattaagtactcatcaaaaatatattaataacttattagtaaatcattgtttgttaggg
aagaaaatagtaaggttaaaaggaggtgatccttccttattcgggcgtcttacagaagaa
gtatatgccttaacgcaagctaattgtaagtacgaaataattcctggtatttcttcagca
ttggcagctcctgtattagctggaattccaattactgataaaaaaataagtcaatgcttc
acaatattaacgggacatgacttaaccatattagactgggaaacattagctagaagtaat
acactaataattctgatgggaataaagaatcttagtaaaattattgataaattaataatt
aatggtaagtcttcaaatgaatcggttgcaatcgttcataattgcggaagttccaatcag
ataacaattacaggaacactaaaaactatagttgataagattgcagctaattatttatct
ccagctattatcataattggagaagtagtaaaattaagaaatatgccatcgtcttctaat
ctccccttagcaggtaaaaaagtaataataactcgttctcatgagtcttctagtcaattt
aaatttcagttgcaagaagctggagcagatgttatcacactacctttgttagaaatacta
ccaccttcttcttgggaaagactagatggagcaattcaagaaatttcatcttttgattgg
ctggttttgacttctgcaaatggggtgaagttttttatggaaagattacatgacttagga
aaagatattcgtattttaaataatattaaaattgctgttgttggtaaaaaaacagctgat
tatttaaagaaattttacttaaaacctaattttataccttctgattttattgctgattca
ttagttgaaaattttccagaagatatcaatggtaaaaagatcttatttcctagggtagag
acaggaggaagagatatacttttaaaagaatttataaaaaaaggggctagtatcactgaa
gtccctgcttatcaatcaatttgccctaaaaatattgataatgaaatatggaaaatatta
aaaaatgagcaagtagatataattacttttactagttctaaaattgttaaacatttctat
catttattcaagaatatatttcctgatagtatagaagaaaaaaagatcttatctaaatta
gataatgtttatctagcatgtattggacctcaaacttcaaaaacctgcaatgatttattt
ggcagagttgatgttgaagcaaaagaatacacgttagaaggcttaactaaccaattaatt
gattacttttcatag

DBGET integrated database retrieval system