KEGG   Cyanobacterium UCYN-A: UCYN_11700Help
Entry
UCYN_11700        CDS       T01159                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cyu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cyu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1321129..1322460
Genome map
AA seq 443 aa AA seqDB search
MTSYIEKKQSVLEIQGQNSLNGQVRVSGAKNSALVLMAGSILCFEDCRLSNIPALADIDR
MSQILTAIGVKLKKNGDSIEINAQNIGQNKAPYELVSQLRASFFVIGPLLARLGKTRVPL
PGGCAIGARPVDLHVRGLQAMGADVQIEHGVVHACIKNNHKKLQGAKIYLDYPSVGATET
IMMAATLAEGETTIENCAQEPEIVDLANFCRSMGAKIKGDGTKRITISGVDYLHSTEYCV
IPDRIEAGTLLIAGAITQSEISLKPVFPEHLASIIAKLKEVGPRVIVEGTDSVTLIPHPL
KATNFKTLPFPGFPTDMQAQFMALLSVSKGSSVITETVFENRLRHIAELQRMGANIRVEG
NIAVVQGVPFLSGAPVMATDLRASAALVLAGLAAHGKTTIQGLHHLDRGYDNLEGKLRKL
GANLRRIDISCNEESSVERSIQI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctatatagaaaagaaacaatcagttttagaaattcaaggtcaaaattctttg
aatggacaagttcgtgtaagtggtgccaaaaattcagctttagttttaatggctgggtca
attctttgttttgaagattgtcgtcttagtaatattcctgctttggctgatattgatcgc
atgtctcaaattcttacagccattggagtaaaacttaaaaaaaatggagacagtatagaa
ataaatgcccaaaatatagggcaaaataaagctccttatgaattagtatcacaacttcga
gctagttttttcgtaattggtcctttattggcaaggttagggaagactcgtgttcccttg
ccaggtggctgtgctataggtgctagaccagtagatcttcatgtaagaggattacaagct
atgggggcagatgttcaaatcgaacatggagtagttcatgcttgtattaaaaataatcac
aagaaactacaaggagctaagatctatttagattatcctagtgttggtgctacagagaca
attatgatggctgcaactttagcagaaggagaaactacaattgagaactgcgcacaagag
cctgagattgtcgacttagcaaacttttgccgttctatgggcgcaaaaataaaaggtgat
gggactaaacgaattaccatatcaggagtagattaccttcatagcactgaatattgtgta
attcctgatcgtattgaggcaggaacattacttatagcaggtgcaattactcaatctgag
attagtttaaagcctgtttttcctgaacatttagcttctatcattgctaagttaaaagaa
gttggtcctagagtcattgttgaaggaacagattccgtaacattaattcctcatccttta
aaagctactaatttcaaaactcttcctttcccaggttttcctacagatatgcaagctcaa
ttcatggctttgctttctgttagtaagggtagtagcgtaatcacagagaccgttttcgag
aatcgtttacgtcacatagcagagttacaacgaatgggggcaaatattcgagttgaaggt
aatattgccgtggtacaaggggtaccttttttatctggcgctcctgttatggctactgat
ttaagagcttctgcagctcttgttctagctgggttagctgctcatgggaaaacaactata
caaggtttacatcatcttgatcgtgggtacgataatctagagggtaaattacgtaaatta
ggagcaaatttacgtagaatcgatatttcttgtaatgaagaaagctcagtggaacgctct
attcaaatttaa

DBGET integrated database retrieval system