KEGG   Cyanobacterium UCYN-A: UCYN_12530Help
Entry
UCYN_12530        CDS       T01159                                 

Definition
putative bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cyu  Cyanobacterium UCYN-A
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    UCYN_12530
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    UCYN_12530
Enzymes [BR:cyu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     UCYN_12530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1414463..1416874)
Genome map
AA seq 803 aa AA seqDB search
MKNSSFGTDIPSCSWQRSIGKGWGNPYTVRYPSNLDDGPWHGMPIGGFGAGCIGRSSAGD
FNLWHLDGGEHVFKTISSCQFSIFEELKDGKTKAYALSTKEPEDKTLSKWNWYPKNKGTY
YALYPRSWYQYEGIFEAKIVCEQFSPIIPDNYQETSYPIGIFEWTVSNPTDQPITLSIML
TWQNMIGWFTNSIKTPKIEVRDDGSPEYEYSPQLGFSQGNFNKWKQSSSQFGFILDRLRV
NDSISEGEGQICFATAHDPDLEFSYLGKWNPSGNGSEVWDHFSASGTLPNTLDETIAKPD
EQIAAAMAVKFVIKPGEVKKIPFTLAWDLPITEFSLGNQYHRRYTDFFGINGKNAWMIAE
TGLKSLNIWREQILEYQLPILNDKDLPDWFKMALFNELYLLTDGGTLWTTSSKSYPVGKF
GVLECIDYRWYESLDVRLYGSFGLLALWPSLEKAVIKTFAESISKSDHTLRLIGYDRSLA
PRKVKGAVPHDLGAPNEHPWEETNYTSYQDCNLWKDLGSDFVLQVYRDFLLTDSQDINFL
QECWPAIVETLDYLKKFDLDDDGIPENSGAPDQTFDDWQLHGISSYCGALWITALEAAIG
IGKILLKNSENNSHPDLQNSLAFIQENLTKYDDWLKKSRLIYHETLWNGEYYQLDSKSGS
DTIMTDQLCGQFYARLLNLPDVVDTSCTISALSKIYEACFLNFYDGQYGAANGVRSDGTP
ENPNSTHPQEVWVGINFGLAAFLIQMGMKNQALELTKVVVEQIYANGLQFRTPEAITPVG
TFRASHYLRAMAIWGVYYQLKKD
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactcatcttttggtaccgatatcccttcctgtagctggcaacgttctattggg
aagggttggggcaatccatacactgtaagatatcctagcaatctagatgatggcccttgg
catggaatgccaattggaggctttggagcaggttgcattggtcgttcttctgccggagat
tttaatttatggcatttagatggtggagagcatgtttttaaaactatttcatcttgtcaa
tttagtatttttgaagaattaaaagatggaaaaactaaagcttatgcattatcaacgaaa
gagccagaagataagactttatctaaatggaattggtatccaaagaataaaggaacttat
tatgcattgtatcctcgtagttggtatcaatatgaaggaatatttgaagcaaaaatagtt
tgtgaacagttctcacctattattcctgataattatcaagagactagctatcctataggt
atttttgaatggacagtatctaatcctacggatcagcctattactttaagcattatgcta
acttggcaaaatatgataggttggtttacaaattcgatcaagactcccaaaattgaagtt
agagatgatggtagtcctgaatacgaatattcgccgcaattaggttttagtcaaggaaat
tttaacaagtggaaacaaagtagttctcaatttggttttatcttagatcgtttacgcgta
aatgattctataagtgaaggcgaaggccaaatatgtttcgctactgctcatgatccagat
ctagaattttcctatttaggtaaatggaatccttctggtaatggctctgaagtttgggat
catttctccgcaagtggaacattaccaaatacattagatgagaccatagctaagccagat
gaacaaatagctgctgctatggcggttaaatttgttattaaacccggagaagttaaaaaa
ataccttttactctagcttgggatttacctattacagaattttcccttggtaatcaatat
catagacggtacactgatttctttggtattaatggtaaaaatgcatggatgatagcagaa
actggactaaagtctttaaatatatggcgagagcaaattcttgaatatcaattacccatc
ttaaatgataaagatttaccagactggtttaaaatggctctgtttaacgagctgtatcta
ttaactgacggcgggactctttggacaacatcttctaaatcttatccagttggtaaattt
ggagttctagaatgtatagattatcgttggtatgaaagtttagatgttagattgtatgga
tcattcggattattagcattatggccgtctctagagaaagcagttatcaaaacattcgca
gaatcaatttctaaaagtgatcatactctaagacttattggttatgacagatctcttgcc
cctaggaaagttaaaggcgcagttcctcatgatttaggtgcaccgaacgaacacccttgg
gaagaaacaaactatactagctatcaagattgtaatttgtggaaagatttaggtagtgat
tttgttttacaagtctatagagattttttgttgacagattctcaagatatcaatttttta
caggaatgttggccagctatagttgaaacattagattacttgaaaaagtttgacctagat
gacgatggtattccagaaaactcaggagcgcctgaccaaacttttgatgattggcagtta
catggaattagttcatattgtggtgccttatggattactgctttggaggctgctattggc
ataggaaagattttactgaaaaatagtgaaaacaattcccatccagatttgcaaaattct
ttagctttcatacaagaaaatcttaccaaatatgatgattggttaaagaaatctcgctta
atttatcatgagactttatggaacggagaatattatcaattagatagcaaaagtggttct
gatacaattatgacggatcagctttgtggccaattttatgcacgcctattaaatttgcct
gatgtagtggatacttcttgtacaatatcagctttgtcaaaaatttacgaagcctgtttt
ttaaacttttatgatggacaatatggagctgccaacggagtaaggtctgatggtacacca
gaaaatcctaattctactcatcctcaagaagtttgggtaggaataaatttcggattagca
gcttttttaatacaaatgggaatgaagaatcaggctttagagttaacaaaagttgtagtt
gaacaaatatatgcgaatggactacagtttagaactcctgaagcaattacaccagtaggg
acttttagagcatctcattatttacgtgctatggctatttggggtgtttactatcaactt
aaaaaagattaa

DBGET integrated database retrieval system