KEGG   Cycloclasticus zancles: CYCME_0970Help
Entry
CYCME_0970        CDS       T02780                                 

Definition
Acetaldehyde dehydrogenase (acetylating)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cza  Cycloclasticus zancles
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cza00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cza00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:cza00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:cza00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:cza00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(961190..962104)
Genome map
AA seq 304 aa AA seqDB search
MEKIKCALIGSGNIGTDLIYKIQRSPYLEPVWMVGIDPESEGLLRAKNMGLKVTSDGVDG
LLPHVLEDNIQIAFDATSAYVHAENSRKLNELGVLMIDLTPAAIGPLCVPPVNLSQHTEK
LEMNVNMISCAGQATIPIISAVSGIQSVEYAEIVASLASKSVGIGTRENLDEFTYTTSSA
IETVGGARKGKALAIINPAEPPLIMRNTIYCITDDKPQEDKIVESILNMIEEVKKYVPGY
KLINGPIFDGNKISVFMEVEGLGDYLPKYAGNLDVMTAAATRTAEMFAEEIQNGTITLKP
VEAA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatcaagtgcgcattgattggatctggcaatattggcacagatcttatctat
aaaattcaaagaagcccttaccttgaacctgtttggatggtaggtattgatccagagtct
gaaggtttgctccgcgctaaaaatatgggcctcaaggtaacctctgatggtgtcgatggt
ttattacctcatgtgcttgaagacaatattcaaatagcctttgatgcaaccagtgcctat
gttcacgctgaaaacagccgtaaacttaatgagcttggcgtgttaatgattgatttaaca
ccagccgctattggccccttatgtgtcccacccgttaacttaagccagcatactgaaaaa
cttgaaatgaacgtaaatatgatttcatgtgcagggcaagccactattcctattatcagc
gcggtatcaggcattcaatctgttgagtatgcagagattgtggccagccttgcttcaaag
tctgttggcattggtactcgtgaaaaccttgacgagttcacttatacaacctccagtgct
attgaaacggttggcggtgctcgtaaaggcaaggccttagcgatcattaaccctgctgaa
cccccacttattatgcgtaatactatttactgtattaccgatgataaaccacaggaagac
aagatcgttgagtccatcctaaatatgattgaagaagttaaaaagtacgtcccaggctac
aagcttattaatgggcctatttttgatggcaataaaatttctgtgtttatggaagttgaa
gggcttggtgactatttacccaaatacgctggcaaccttgatgtaatgactgctgctgcc
actagaacggcagagatgttcgcggaagaaattcaaaatggaacaataactcttaaacct
gtggaggctgcgtaa

DBGET integrated database retrieval system